—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Childcare Family ↔ relates to ↔ Insurance Coverage

21 Wikipedia bridge articles confirmed in both vertical ledgers. 261 deterministic cross-vertical edges. 6,639 external source links harvested. Every edge provenance-stamped. Every claim auditable.

21 QID Bridge Articles
261 Cross Edges
6,639 External Sources
301 Wikipedia Articles
23 🌲 Evergreen
168 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Childcare Family
× Insurance Coverage
QID Bridge Articles
21
confirmed Wikipedia overlap
Total Cross Edges
261
External Sources Harvested
6,639
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
College of Western Idaho
score: 1.1500  ·  type: exact_title_cross  ·  26 shared tokens
QID Bridge Titles (20)
College of Western IdahoIdahoMedicaidContinuing educationBoise State UniversityTreasure ValleyReputation managementBoise, IdahoOccupational licensingTrinity HealthOnline marketplaceSocial Security ActBoise metropolitan areaNampa, IdahoMeridian, IdahoCustomer reviewAda County, IdahoStar, IdahoCanyon County, IdahoCaldwell, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationadacanyonhomecollegeprogramsnampanorthtreasurevalleywesterncapitalproductsgeneralhealthsupporteducationpublic
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:51:03 UTC
Content Hash
e5b2bdd0e68b6fbc
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
21 BRIDGES
College of Western Idaho
Q5146875 EXACT TITLE 1.150
QID OVERLAP: Q5146875 in childcare_family (tier:evergreen) and insurance_coverage (tier:evergreen). | SHARED TOKENS (26): "ada", "boise", "campus", "canyon", "college", "comprehensive", "cwi", "development", "education", "governed", "idaho", "nampa", "north", "population", "primary", "programs", "public", "reported", "residents", "served".... | URL->B (1): https://cwi.edu/. | EXACT TITLE in childcare_family: "College of Western Idaho". | EXACT TITLE in insurance_coverage: "College of Western Idaho".
adaboisecampuscanyoncollegecomprehensivecwidevelopmenteducationgovernedidahonampanorthpopulationprimaryprogramspublicreportedresidentsservedstudentstechnicaltreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in childcare_family (tier:evergreen) and insurance_coverage (tier:evergreen). | SHARED TOKENS (30): "agriculture", "associated", "boise", "capital", "century", "contains", "disputed", "economy", "geographic", "idaho", "isolated", "july", "land", "national", "north", "official", "periods", "population", "products", "relatively".... | EXACT TITLE in childcare_family: "Idaho". | EXACT TITLE in insurance_coverage: "Idaho".
agricultureassociatedboisecapitalcenturycontainsdisputedeconomygeographicidahoisolatedjulylandnationalnorthofficialperiodspopulationproductsrelativelyriversectorseparatesmallsouthsuppliestechnologyuseswesternzone
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
In 2025, the gross state product (state GDP) for Idaho was $135.5 billion and the state's per capita personal income was $64,846. Idaho had the 39th highest GDP per capita in the United States of America in 2025. In 2025, small businesses made up 99.2% and employed 56.0% of the state's work force. As of May 2025, the state's unemployment rate was 3.6%. Total employment in Idaho in 2024 was 965,824. Idaho is the top potato producing state in the United States and almost one-third of the nation's potatoes are grown in the Snake River Plain, a belt of low-lying land that extends across southern Idaho. Important industries in Idaho are food processing, lumber and wood products, machinery, chemical products, paper products, electronics manufacturing, silver and other mining, and tourism. The world's largest factory for barrel cheese, the raw product for processed cheese, is in Gooding, Idaho. It has a capacity of 120,000 metric tons per year of barrel cheese and belongs to the Glanbia group. As Idaho neared statehood, mining and other extractive industries played a significant role in its economy. Although the state's reliance on mining has diminished over time, Idaho remains renowned as "The Gem State" due to its production of seventy-two varieties of precious and semi-precious stones. Idaho is a leading national producer of potatoes, trout, Austrian winter peas, and lentils. The state's primary industries include manufacturing, agriculture, food processing, timber, and mining. Tourism is another way that Idaho capitalizes on its natural resources.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Medicaid
Q1141363 EXACT TITLE 1.000
QID OVERLAP: Q1141363 in childcare_family (tier:evergreen) and insurance_coverage (tier:evergreen). | SHARED TOKENS (47): "access", "act", "affordable", "annual", "assets", "care", "cost", "costs", "covered", "economic", "eligibility", "established", "expanded", "families", "federal", "financial", "general", "health", "healthcare", "home".... | EXACT TITLE in childcare_family: "Medicaid". | EXACT TITLE in insurance_coverage: "Medicaid".
accessactaffordableannualassetscarecostcostscoveredeconomiceligibilityestablishedexpandedfamiliesfederalfinancialgeneralhealthhealthcarehomehourshouseholdinsurancelevelslimitedlinemaintainmedicalpersonalpolicy+17
Medicaid is the largest source of funding for medical and health-related services for people with low income in the United States, providing taxpayer-funded health insurance to 85 million low-income and disabled people as of 2022; in 2019, the program paid for half of all U.S. births. In 2023, the total (federal and state) annual cost of Medicaid was $870 billion, with an average cost per enrollee of $7,600 for 2021. 37% of enrollees were children, but they only accounted for 15% of the spending, ($3,000 per person) while seniors and disabled persons accounted for 21% of enrollees and 52% of spending (more than $18,000 per person). In general, Medicaid recipients must be U.S. citizens or qualified non-citizens, and may include low-income adults, their children, and people with certain disabilities. Medicaid also covers long-term services and supports, including both nursing home care and home- and community-based services, for those with low incomes and minimal assets. Of the 7.7 million Americans who used long-term services and supports in 2020, about 5.6 million were covered by Medicaid. Along with Medicare, Tricare, ChampVA, and CHIP, Medicaid is one of the several Federal Government-sponsored medical insurance programs in the United States. Medicaid covers healthcare costs for people with low incomes; Medicare is a universal program providing health coverage for the elderly; and the CHIP program covers uninsured children in families with incomes that are too high to be covered by Medicaid. Medicaid offers elder care benefits not normally covered by Medicare, including nursing home care and personal care services. There are also dual health plans for people who have both Medicaid and Medicare. Research shows that existence of the Medicaid program improves health outcomes, health insurance coverage, access to health care, and recipients' financial security and provides economic benefits to states and health providers.
2025 Medicaid cuts in the second Trump administration In 2025, Republican Congressional leaders John Thune and Mike Johnson announced goals of cutting 1.5 to 2 trillion dollars of the US federal budget, with President Donald Trump stating that cuts to Medicaid would only include "abuse or waste". The 2025 budget resolution, which was passed by the House of Representatives with only Republicans votes, proposed cutting $880 billion from the Standing Committee for Energy and Commerce, which includes many areas, such as Medicaid and Medicare. On July 4, 2025, President Donald Trump signed the One Big Beautiful Bill Act, intended in part to implement this resolution. The act cut Medicaid in a number of ways: while it did not repeal the ACA's Medicaid expansion, it mandated work requirements for able-bodied Medicaid recipients. It also requires Medicaid recipients above the federal poverty line to pay more fees for coverage; adds new verification requirements; increases the number of times states need to check the eligibility of their Medicaid expansion recipients; prohibits Medicaid from funding nonprofits that provide abortion care; makes it harder for illegal immigrants to use Medicaid; bans pharmacy benefit managers from using spread pricing; and puts limits on so-called "provider taxes" that states impose on healthcare providers to fund their portion of Medicaid spending. The non-partisan Congressional Budget Office (CBO) estimated that it will reduce the number of people on Medicaid by several million.; the CBO estimates that the work requirements in particular will lead 11 million to lose their Medicaid coverage, many of whom already work or qualify for exemptions but will not be able to get through the red tape. The bill prompted claims that undocumented immigrants are on Medicaid. Undocumented immigrants are already ineligible for full Medicaid benefits, and many undocumented immigrants access state-funded health programs rather than federal Medicaid. According to a CBO analysis, the bill's provisions could lead some states to cut back those state-funded health programs, potentially causing an estimated 1.4 million people to lose state-level health coverage, including undocumented immigrants. When commenting on the Trump administration's One Big Beautiful Bill Act and the impact of the Medicaid provisions on the economy, USDA Secretary Brooke Rollins stated that 34 million able-bodied adults on Medicaid should be working.
Arizona: AHCCCS California: Medi-Cal Connecticut: HUSKY D Illinois: HealthChoice Illinois Iowa: Hawk-i Healthy and Well-Kids in Iowa Maine: MaineCare Massachusetts: MassHealth New Jersey: NJ FamilyCare Oregon: Oregon Health Plan Oklahoma: Soonercare Tennessee: TennCare Washington: Washington Apple Health Wisconsin: BadgerCare As of January 2012, Medicaid and/or CHIP funds could be obtained to help pay employer health care premiums in Alabama, Alaska, Arizona, Colorado, Florida, and Georgia. Differences by state While states have significant autonomy in implementing the Medicaid program, their flexibility is bounded by federal requirements designed to ensure a baseline of coverage and access. For example, federal law mandates that certain services, such as inpatient and outpatient hospital services, laboratory and X-ray services, and physician services, must be covered by all state Medicaid programs. Additionally, states must adhere to federal guidelines regarding beneficiary protections and quality standards.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in childcare_family (tier:evergreen) and insurance_coverage (tier:evergreen). | SHARED TOKENS (28): "activities", "agencies", "beyond", "college", "continuing", "curriculum", "development", "economic", "education", "especially", "formal", "frequently", "general", "institutional", "intended", "least", "personal", "professional", "programs", "rather".... | EXACT TITLE in childcare_family: "Continuing education". | EXACT TITLE in insurance_coverage: "Continuing education".
activitiesagenciesbeyondcollegecontinuingcurriculumdevelopmenteconomiceducationespeciallyformalfrequentlygeneralinstitutionalintendedleastpersonalprofessionalprogramsratherseparatestaffstudentssupporttrainingtypeuniversityworkforce
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
n". Georgetown University, Michigan State University, and the University of Denver have benefited from non-credit programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
aining, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in childcare_family (tier:evergreen) and insurance_coverage (tier:evergreen). | SHARED TOKENS (16): "activity", "among", "boise", "business", "college", "education", "engineering", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "university". | EXACT TITLE in childcare_family: "Boise State University". | EXACT TITLE in insurance_coverage: "Boise State University".
activityamongboisebusinesscollegeeducationengineeringhealthidahoindependentprogramprogramspublicreportedresearchuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in childcare_family (tier:evergreen) and insurance_coverage (tier:evergreen). | SHARED TOKENS (12): "association", "boise", "historically", "idaho", "land", "local", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in childcare_family: "Treasure Valley". | EXACT TITLE in insurance_coverage: "Treasure Valley".
associationboisehistoricallyidaholandlocalregionresourcesrivertreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
R
Q478594 QID OVERLAP 0.800
QID OVERLAP: Q478594 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (24): "communities", "complaints", "control", "customer", "data", "digital", "fees", "group", "individual", "influence", "management", "marketing", "markets", "networks", "organizations", "product", "products", "related", "reputation", "review"....
communitiescomplaintscontrolcustomerdatadigitalfeesgroupindividualinfluencemanagementmarketingmarketsnetworksorganizationsproductproductsrelatedreputationreviewsearchsitesspacesystems
arily – from their websites. Online reputation management, or ORM, focuses on the management of product and service search results within the digital space. A variety of electronic markets and online communities, such as eBay, Amazon, and Alibaba, have ORM systems built in, and using effective control nodes can minimize the threat and protect systems from possible misuses and abuses by malicious nodes in decentralized overlay networks.
ed to products and services. The ethical gray areas of online reputation management include the removal of mug shots from websites, the use of astroturfing in customer review sites, the censorship of complaints, and the use of search engine optimization tactics to influence results. In other cases, the ethical lines are clear; some reputation management companies are closely connected to websites that publish unverified and libelous statements about people. These unethical companies often impose exorbitant fees, amounting to thousands of dollars, to remove these posts – temporarily – from their websites. Online reputation management, or ORM, focuses on the management of product and service search results within the digital space. A variety of electronic markets and online communities, such as eBay, Amazon, and Alibaba, have ORM systems built in, and using effective control nodes can minimize the threat and protect systems from possible misuses and abuses by malicious nodes in decentralized overlay networks.
Reputation management is the deliberate influence, control, enhancement, or concealment of an individual's or group's reputation. It is a marketing technique used to modify a person's or a company's reputation in a positive way. Online reputation management (ORM) involves overseeing and influencing the search engine results related to products and services. The ethical gray areas of online reputation management include the removal of mug shots from websites, the use of astroturfing in customer review sites, the censorship of complaints, and the use of search engine optimization tactics to influence results. In other cases, the ethical lines are clear; some reputation management companies are closely connected to websites that publish unverified and libelous statements about people. These unethical companies often impose exorbitant fees, amounting to thousands of dollars, to remove these posts – temporarily – from their websites. Online reputation management, or ORM, focuses on the management of product and service search results within the digital space. A variety of electronic markets and online communities, such as eBay, Amazon, and Alibaba, have ORM systems built in, and using effective control nodes can minimize the threat and protect systems from possible misuses and abuses by malicious nodes in decentralized overlay networks.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "level", "locally", "major", "north", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalemployershomeidaholevellocallymajornorthpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
O
Q7075804 QID OVERLAP 0.800
QID OVERLAP: Q7075804 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (43): "business", "compensation", "consumer", "creates", "customer", "economic", "form", "free", "frequently", "general", "growth", "health", "higher", "individual", "individuals", "inspections", "law", "least", "license", "licensed"....
businesscompensationconsumercreatescustomereconomicformfreefrequentlygeneralgrowthhealthhigherindividualindividualsinspectionslawleastlicenselicensedlicensinglicensuremarketmechanismsoccupationoccupationspermittingpracticesprofessionalprotection+13
ue to anti-competitive practices. Alternatives to individual licensing include only requiring that at least one person on a premises be licensed to oversee unlicensed practitioners, permitting of the business overall, random health and safety inspections, general consumer protection laws, and deregulation in favor of voluntary professional certification schemes or free market mechanisms such as customer review sites.
History Traditionally, occupations in the crafts professions and in the liberal professions organize their respective industries in guilds and chambers in European countries like Germany and Austria. One of the most important changes in licensing has been the 2004 reform in Germany, where workers in 53 of 94 crafts professions were not required to be licensed anymore in order to start a business. In 2020, 12 of these deregulated professions reinstated the licensing requirement. Types In the United States and Canada, licensing (the term registration is sometimes used) is usually required by law to work in a particular profession or to obtain a privilege such as to drive a car or truck. Many other privileges and professions require a license, generally from the state or provincial government, in order to ensure that the public will not be harmed by the incompetence of the practitioners, and to limit supply to incumbent practitioners and thus increase wages. Examples of professions that require licensure in some jurisdictions include: actuary, architect, certified public accountant, electrician, engineering, general contractors, financial analyst, geologists, hedge fund manager, insurance agent, interior design, investment banker, licensed professional counselor, nurse, occupational therapist, physical therapist, plumber, private investigator, psychologist, landscape architect, lawyer, nutritionist, physician, real estate broker, speech-language pathologist, school counselor, social worker, stockbroker, surveyor, and teacher. Licensure is similar to professional certification, and sometimes synonymous (such as in the case with teacher licensure/certification); however, certification is an employment qualification and not a legal requirement for practicing a profession. In many cases, an individual must complete certain steps, such as training, acquiring an academic degree in a particular area of study, and/or passing an exam, before becoming eligible to receive their license. There are various resources available to assist professionals with the completion of these steps. Professional associations are often a tremendous resource to individuals looking to obtain a special level of certification or licensure.
Historically, in the professionalization process by which trades have transformed themselves into true professions, licensing fast became the method of choice in obtaining the occupational closure required by barring competition from entry to the rites and privileges of a professional group. This was initially the preferred route of regulation whether for physicians, lawyers, the clergy, accountants, bankers, scientists, engineers or architects. However, licensing has given way to membership of professional bodies, as a means of excluding competition. Licensure restricts entry into professional careers in medicine, nursing, law, business, accounting, pharmacy, psychology, social work, teaching, engineering, surveying, and architecture. Advocates claim that licensure protects the consumer through the application of professional, educational and/or ethical standards of practice. Economist Milton Friedman opposed this practice, believing that licensure effectively raises professional salary by placing limits on the supply of specific occupations. "It is hard to regard altruistic concern for their customers as the primary motive behind their determined efforts to get legal power to decide who may be a plumber." Restricting entry by licensing arguably maintains higher standards of service within a profession as well as acting to eliminate competition from those who provide a cheaper but (allegedly) sub-standard service. Organizations such as the American Medical Association were explicitly set up to restrict the number of practitioners. However, libertarians like Milton Friedman have argued that this process is counterproductive as it seriously restricts the number of active professionals working in society and thus unnecessarily inhibits the working of a free enterprise economy. A 2011 U.S. study estimated that occupational licenses result in 2.8 million fewer jobs, and cost the economy $203 billion per year. The number of jobs requiring a professional licensed represents an increasing fraction of the workforce, from 5% in 1950 to 22% in 2010s. Critics say that low-income consumers, who pay higher prices than required for the level of quality they might require, and low-income job seekers, are disproportionately affected. In the United States, critics have pointed out that (as of 2018) only 60 professions are licensed by all 50 states, but about 1100 by at least one state, including tour guides, bartenders, and interior designers. If many professions are functioning satisfactorily unlicensed in the majority of states, this implies to critics that the licensing is unnecessary for consumer protection. The administrations of both President Obama and President Trump have tried to pressure state and local authorities to reduce overly burdensome licensing requirements.
T
QID OVERLAP 0.800
QID OVERLAP: Q7842827 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (16): "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "home", "hospital", "idaho", "network", "north", "operates", "operating", "south", "support", "system".
carecomprehensivecontinuingfacilitieshealthhealthcarehomehospitalidahonetworknorthoperatesoperatingsouthsupportsystem
Trinity Health is an American not-for-profit Catholic health system operating 92 hospitals in 22 states, including 120 continuing care locations encompassing home care, hospice, PACE and senior living facilities. Based in Livonia, Michigan, Trinity Health employs more than 120,000 people including 5,300 physicians. Sponsored by Catholic Health Ministries, Trinity Health operates facilities in the US states of Alabama, California, Connecticut, Delaware, Florida, Georgia, Idaho, Illinois, Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area.
Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area. The system includes a hospital, a network of outpatient clinics, and a variety of support services. History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
O
Q3390477 QID OVERLAP 0.800
QID OVERLAP: Q3390477 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (18): "availability", "consumer", "general", "higher", "information", "multiple", "operator", "participating", "primary", "process", "product", "products", "providers", "segment", "single", "site", "type", "types".
availabilityconsumergeneralhigherinformationmultipleoperatorparticipatingprimaryprocessproductproductsproviderssegmentsinglesitetypetypes
s of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
information is provided by multiple third parties. Online marketplaces are the primary type of multichannel ecommerce and can be a way to streamline the production process. In an online marketplace, consumer transactions are processed by the marketplace operator and then delivered and fulfilled by the participating retailers or wholesalers. These types of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
is wider, and availability is higher than in vendor-specific online retail stores. Some online marketplaces have a wide variety of general interest products that cater to almost all the needs of the consumers, others are consumer specific and cater to a particular segment. B2B online marketplaces Business-to-business (B2B) online marketplaces are platforms that allow companies to buy and sell products or services to other businesses. These marketplaces typically focus on a specific product or service category and are used by businesses to find suppliers, negotiate prices, and manage logistics. Some examples of B2B online marketplaces include VerticalNet, Commerce One, and Covisint, which were some of the earliest B2B marketplaces to emerge in the early days of e-commerce.
Social Security Act
Q7550813 QID OVERLAP 0.800
QID OVERLAP: Q7550813 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (22): "act", "administered", "against", "among", "direct", "established", "families", "federal", "healthcare", "insurance", "labor", "law", "major", "national", "payments", "program", "programs", "security", "single", "support"....
actadministeredagainstamongdirectestablishedfamiliesfederalhealthcareinsurancelaborlawmajornationalpaymentsprogramprogramssecuritysinglesupportsystemwelfare
The Social Security Act of 1935 is a law enacted by the 74th United States Congress and signed into law by U.S. President Franklin D. Roosevelt on August 14, 1935. The law created the Social Security program as well as insurance against unemployment. The law was part of Roosevelt's New Deal domestic program. By 1930, the United States was one of the few industrialized countries without any national social security system. Amid the Great Depression, the physician Francis Townsend galvanized support behind a proposal to issue direct payments to older people. Responding to that movement, Roosevelt organized a committee led by Secretary of Labor Frances Perkins to develop a major social welfare program proposal. Roosevelt presented the plan in early 1935 and signed the Social Security Act into law on August 14, 1935. The Supreme Court upheld the act in two major cases decided in 1937. The law established the Social Security program. The old-age program is offset by payroll taxes, and over the ensuing decades, it contributed to a dramatic decline in poverty among older people, and spending on Social Security became a significant part of the federal budget. The Social Security Act also established an unemployment insurance program administered by the states and the Aid to Dependent Children program, which provided aid to families headed by single mothers.
Roosevelt organized a committee led by Secretary of Labor Frances Perkins to develop a major social welfare program proposal. Roosevelt presented the plan in early 1935 and signed the Social Security Act into law on August 14, 1935. The Supreme Court upheld the act in two major cases decided in 1937. The law established the Social Security program. The old-age program is offset by payroll taxes, and over the ensuing decades, it contributed to a dramatic decline in poverty among older people, and spending on Social Security became a significant part of the federal budget. The Social Security Act also established an unemployment insurance program administered by the states and the Aid to Dependent Children program, which provided aid to families headed by single mothers.
ces Perkins to develop a major social welfare program proposal. Roosevelt presented the plan in early 1935 and signed the Social Security Act into law on August 14, 1935. The Supreme Court upheld the act in two major cases decided in 1937. The law established the Social Security program. The old-age program is offset by payroll taxes, and over the ensuing decades, it contributed to a dramatic decline in poverty among older people, and spending on Social Security became a significant part of the federal budget. The Social Security Act also established an unemployment insurance program administered by the states and the Aid to Dependent Children program, which provided aid to families headed by single mothers.
Boise metropolitan area
Q4938481 QID OVERLAP 0.780
QID OVERLAP: Q4938481 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (14): "ada", "boise", "canyon", "cities", "home", "idaho", "larger", "meridian", "nampa", "percent", "population", "section", "treasure", "valley".
adaboisecanyoncitieshomeidaholargermeridiannampapercentpopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "population", "principal", "second", "university", "western".
boisecanyoncollegehomeidahomeridiannampapopulationprincipalseconduniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
C
Q5196473 QID OVERLAP 0.700
QID OVERLAP: Q5196473 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (10): "customer", "decisions", "experience", "form", "product", "products", "professional", "purchasing", "review", "sites".
customerdecisionsexperienceformproductproductsprofessionalpurchasingreviewsites
A customer review is an evaluation of a product or service made by someone who has purchased and used, or had experience with, a product or service. Customer reviews are a form of customer feedback on electronic commerce and online shopping sites. There are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users.
here are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines.
or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines. These methods still exist today although internet review sites are used more in recent years. Reliability The reliability of customer reviews has been questioned. Abuses akin to ballot stuffing of favourable reviews by the seller (known as incentivized reviews), or negative reviews by competitors, need to be policed by the review host site. Indeed, gathering fake reviews has become big business. In 2012, for example, fake book reviews have been revealed as significantly affecting ratings on Amazon. In 2016 Amazon banned the practice of reviewing complimentary products, researchers have shown that the process still continued as of 2021, but without any disclosures. Since few sites restrict users to reviewing only items they have actually purchased, it is difficult to know if a customer is real, has actually used the product they are reviewing, and is giving honest, unbiased feedback about the product or services being reviewed. Tools like Fakespot and ReviewMeta can help spot fake reviews on shopping sites like Amazon. Unfortunately, the tools do not work on most other websites that show customer reviews. Public calls have been growing stronger, demanding that review sites be held accountable for publishing fake reviews. Most recently (June 2021), the Competition and Markets Authority (CMA) in the United Kingdom has launched an investigation into whether Amazon and Google are doing enough to prevent fake reviews from being published on their sites. Both businesses claim to have sufficient resources and policies in place to prevent fake reviews from being published. Legal steps could be taken against the giants if CMA determines those claims to be false.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in childcare_family (tier:evergreen) and insurance_coverage (tier:branch). | SHARED TOKENS (9): "ada", "boise", "capital", "home", "idaho", "local", "population", "private", "second".
adaboisecapitalhomeidaholocalpopulationprivatesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Star, Idaho
Q1516815 QID OVERLAP 0.660
QID OVERLAP: Q1516815 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (8): "ada", "boise", "canyon", "century", "idaho", "population", "schools", "star".
adaboisecanyoncenturyidahopopulationschoolsstar
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
boisecaldwellcanyoncollegeidaholocallypopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in childcare_family (tier:branch) and insurance_coverage (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
240 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP240 edges
🌲 EVERGREEN2 edges
0.650
actadequateadministeredadministrationagainstagencyaprilassistanceavailabilitybuildingscommunitiesconstructioncontrolcostcostscovereddevelopmentenforcementfederalgenerally
SHARED TOKENS (38): "act", "adequate", "administered", "administration", "against", "agency", "april", "assistance", "availability", "buildings", "communities", "construction", "control", "cost", "costs", "covered", "development", "enforcement", "federal", "generally".... | URL->B (1): http://www.floodsmart.gov/. | EXACT TITLE in insurance_coverage: "National Flood Insurance Program".
0.610
administrativeagencycompensationdecisionsdepartmentestablishedidahoindustrialinsuranceissuedlaborsystemworkers
SHARED TOKENS (13): "administrative", "agency", "compensation", "decisions", "department", "established", "idaho", "industrial", "insurance", "issued", "labor", "system", "workers". | URL->B (1): https://iic.idaho.gov/. | EXACT TITLE in insurance_coverage: "Idaho Industrial Commission".
🌿 BRANCH168 edges
0.590
careeducationnetworkoperatedoperatesownedownersprivateprogramsproviderprovidingschools
SHARED TOKENS (12): "care", "education", "network", "operated", "operates", "owned", "owners", "private", "programs", "provider", "providing", "schools". | URL->A (1): https://www.roarkcapital.com/files/Primrose-Press_Release.pdf. | EXACT TITLE in childcare_family: "Primrose Schools".
0.500
Parenting ↗ Q1217379 EXACT TITLE
affectassociatedcaredevelopmenteducationalfamilyhistoryinfluencelegalparticularlypersonalphysicalprocessproviderprovidersreceiverelationshipresearchrolesingle
SHARED TOKENS (21): "affect", "associated", "care", "development", "educational", "family", "history", "influence", "legal", "particularly", "personal", "physical", "process", "provider", "providers", "receive", "relationship", "research", "role", "single".... | EXACT TITLE in childcare_family: "Parenting".
0.500
accreditationagencyassociationbusinessbusinessescenturycodecomplaintcustomerevenindustryjulylocalmarketingmissionnorthoperatingorganizationorganizationspolicy
SHARED TOKENS (26): "accreditation", "agency", "association", "business", "businesses", "century", "code", "complaint", "customer", "even", "industry", "july", "local", "marketing", "mission", "north", "operating", "organization", "organizations", "policy".... | EXACT TITLE in insurance_coverage: "Better Business Bureau".
0.500
activitiesaffectamongbroadercreatedecisionsdefinesdetermineshealthindividuallevelmerelyorganizationpersonalprofessionalratherrelationshipsrolework
SHARED TOKENS (19): "activities", "affect", "among", "broader", "create", "decisions", "defines", "determines", "health", "individual", "level", "merely", "organization", "personal", "professional", "rather", "relationships", "role", "work". | EXACT TITLE in childcare_family: "Mental health".
0.500
Family court ↗ Q82749 EXACT TITLE
againstcenturychangescourtsdecisionsfamilyjurisdictionslawlegalmattersrelationshipsrequirementsrulessupportsystem
SHARED TOKENS (15): "against", "century", "changes", "courts", "decisions", "family", "jurisdictions", "law", "legal", "matters", "relationships", "requirements", "rules", "support", "system". | EXACT TITLE in childcare_family: "Family court".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addcreatecreatesdependdirecteconomicequipmentespeciallyfiregrowthhealthlandland-uselevellevelsmanagementmaterialparticularlyperiodsphysical
SHARED TOKENS (27): "add", "create", "creates", "depend", "direct", "economic", "equipment", "especially", "fire", "growth", "health", "land", "land-use", "level", "levels", "management", "material", "particularly", "periods", "physical".... | EXACT TITLE in childcare_family: "Wildfire". | EXACT TITLE in insurance_coverage: "Wildfire".
0.500
agencyamongapprovedcareclientscompensationdatadecisionsdescribedespeciallyfamiliesfamilygeneralgrouphealthhigherhomelegalmakingparent
SHARED TOKENS (35): "agency", "among", "approved", "care", "clients", "compensation", "data", "decisions", "described", "especially", "families", "family", "general", "group", "health", "higher", "home", "legal", "making", "parent".... | EXACT TITLE in childcare_family: "Foster care".
0.500
addedadditionalbeyondbusinesscapacitycategoriesdescriptiongeneralgenerallyidentifiesidentifyinsuranceoperationsorganizationpersonalpolicypropertyprotectionprovideprovisions
SHARED TOKENS (25): "added", "additional", "beyond", "business", "capacity", "categories", "description", "general", "generally", "identifies", "identify", "insurance", "operations", "organization", "personal", "policy", "property", "protection", "provide", "provisions".... | EXACT TITLE in insurance_coverage: "Additional insured".
0.500
Living wage ↗ Q543406 EXACT TITLE
additionalauthoritycaredefineddefinitiondemanddiscoveryeconomiceconomyemploymenteventsfamilyhealthhourshouseholdhousinglaborlegallinemedian
SHARED TOKENS (36): "additional", "authority", "care", "defined", "definition", "demand", "discovery", "economic", "economy", "employment", "events", "family", "health", "hours", "household", "housing", "labor", "legal", "line", "median".... | EXACT TITLE in childcare_family: "Living wage".
0.500
accessaccountaffectagenciesauthoritiesbeyondcomprehensivecoordinationcreatedefinesdevelopmenteconomiceducationespeciallyevenfamiliesfamilyfreehealthhealthcare
SHARED TOKENS (48): "access", "account", "affect", "agencies", "authorities", "beyond", "comprehensive", "coordination", "create", "defines", "development", "economic", "education", "especially", "even", "families", "family", "free", "health", "healthcare".... | EXACT TITLE in childcare_family: "Child protection".
0.500
agreementsassociatedcontractscontractualcourtscovereddeterminesexchangefinalformfoundgenerallyinsurancelanguagelegallypolicyrequiredrulesubjecttypes
SHARED TOKENS (20): "agreements", "associated", "contracts", "contractual", "courts", "covered", "determines", "exchange", "final", "form", "found", "generally", "insurance", "language", "legally", "policy", "required", "rule", "subject", "types". | EXACT TITLE in insurance_coverage: "Insurance policy".
0.500
actadditionalaffordablecannotcarechangescostscoverededucationeligibilityemployeressentialexpandedfederalfoundhealthhealthcareheldincreasesindividual
SHARED TOKENS (46): "act", "additional", "affordable", "cannot", "care", "changes", "costs", "covered", "education", "eligibility", "employer", "essential", "expanded", "federal", "found", "health", "healthcare", "held", "increases", "individual".... | EXACT TITLE in insurance_coverage: "Affordable Care Act".
0.500
additionalauthoritybenefitcapacitychangescourtscreatedatadevelopmentgeneralincreasesincreasinglylegallocallymodelparentparticularlypracticeprotectionquestions
SHARED TOKENS (28): "additional", "authority", "benefit", "capacity", "changes", "courts", "create", "data", "development", "general", "increases", "increasingly", "legal", "locally", "model", "parent", "particularly", "practice", "protection", "questions".... | EXACT TITLE in childcare_family: "Juvenile court".
0.500
assetsbroaderbuildingscapitalcategoryconstructiondirectlyeconomicemploymentfacilitieshealthinfrastructuremunicipaloperatorphysicalprivateprotectionpublicschoolstreatment
SHARED TOKENS (22): "assets", "broader", "buildings", "capital", "category", "construction", "directly", "economic", "employment", "facilities", "health", "infrastructure", "municipal", "operator", "physical", "private", "protection", "public", "schools", "treatment".... | EXACT TITLE in insurance_coverage: "Public works".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstamountanothercoveredespeciallyestablishedexchangefinancialformhealthinsurancemanagementmandatoryownershippolicyprimaryprotectionreceivesrelationshiprelatively
SHARED TOKENS (24): "against", "amount", "another", "covered", "especially", "established", "exchange", "financial", "form", "health", "insurance", "management", "mandatory", "ownership", "policy", "primary", "protection", "receives", "relationship", "relatively".... | EXACT TITLE in childcare_family: "Insurance". | EXACT TITLE in insurance_coverage: "Insurance".
0.500
businessbusinessescapacitycommercialcustomerdefinedexpandedfamiliesfamilygenerallyhelphomeofficeoperateoperatedoperatessecondsmalltypework
SHARED TOKENS (21): "business", "businesses", "capacity", "commercial", "customer", "defined", "expanded", "families", "family", "generally", "help", "home", "office", "operate", "operated", "operates", "second", "small", "type", "work".... | EXACT TITLE in childcare_family: "Home business".
0.500
Indeed ↗ EXACT TITLE
additionalallowingbegancomdirectlyemployersemploymentfirmsheadquarteredindependentnovemberrecruitsearchsinglesitevertical
SHARED TOKENS (16): "additional", "allowing", "began", "com", "directly", "employers", "employment", "firms", "headquartered", "independent", "november", "recruit", "search", "single", "site", "vertical". | EXACT TITLE in childcare_family: "Indeed".
0.500
Indemnity ↗ Q708399 EXACT TITLE
agencyanothercompensationcontractscontractualeventsexpresslyforminsurancelawlimitedmedicalprincipalrelationshiprelevantspecified
SHARED TOKENS (16): "agency", "another", "compensation", "contracts", "contractual", "events", "expressly", "form", "insurance", "law", "limited", "medical", "principal", "relationship", "relevant", "specified". | EXACT TITLE in insurance_coverage: "Indemnity".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessactivitiesadequateapplicablecommunitiescontactdefineddevelopmenteconomyespeciallygeneralgrowthhealthlevellevelslimitedoperatingparticularlypersonalproviding
SHARED TOKENS (32): "access", "activities", "adequate", "applicable", "communities", "contact", "defined", "development", "economy", "especially", "general", "growth", "health", "level", "levels", "limited", "operating", "particularly", "personal", "providing".... | EXACT TITLE in childcare_family: "Sanitation".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherapplicationcaredatadefinesdigitaleducationevenfacilitieshealthhealthcarehigherhomeinformationlimitedmanagementmedicalphysical
SHARED TOKENS (33): "access", "administration", "another", "application", "care", "data", "defines", "digital", "education", "even", "facilities", "health", "healthcare", "higher", "home", "information", "limited", "management", "medical", "physical".... | EXACT TITLE in childcare_family: "Telehealth".
0.500
buildingcommunitiesdevelopmentexperiencehealthmakingmodelnetworksoccursoperateoperatingorganizationorganizationsspacework
SHARED TOKENS (15): "building", "communities", "development", "experience", "health", "making", "model", "networks", "occurs", "operate", "operating", "organization", "organizations", "space", "work". | EXACT TITLE in childcare_family: "Community organization".
0.500
Care work ↗ Q5038877 EXACT TITLE
activitiesassociatedcarecommunitiescompensationcostdatadescribeddevelopmentdirectdistributionemploymentfacefamiliesfamilyformformalgroupidentifiedinstitutions
SHARED TOKENS (37): "activities", "associated", "care", "communities", "compensation", "cost", "data", "described", "development", "direct", "distribution", "employment", "face", "families", "family", "form", "formal", "group", "identified", "institutions".... | EXACT TITLE in childcare_family: "Care work".
0.500
activitiesaddanotherbuildingcapacitycarechangescreatesdefineddevelopmenteducationalespeciallyestablishedfoundationidentityindividualmajormultipleparticularlyperiods
SHARED TOKENS (31): "activities", "add", "another", "building", "capacity", "care", "changes", "creates", "defined", "development", "educational", "especially", "established", "foundation", "identity", "individual", "major", "multiple", "particularly", "periods".... | EXACT TITLE in childcare_family: "Child development".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agricultureapplicationchangescontroldirectlydistributionformgrowthhelplandmaintainmanagementnetworkoccursoperationsoutsidepracticepracticesqualityrequired
SHARED TOKENS (31): "agriculture", "application", "changes", "control", "directly", "distribution", "form", "growth", "help", "land", "maintain", "management", "network", "occurs", "operations", "outside", "practice", "practices", "quality", "required".... | EXACT TITLE in insurance_coverage: "Irrigation".
0.500
amongcostseducationespeciallyestablishesgeneralheadquarteredmajormissionnationalofficialoperatingparticularlyphysicalpracticeproviderreportsretainedsecondstructure
SHARED TOKENS (21): "among", "costs", "education", "especially", "establishes", "general", "headquartered", "major", "mission", "national", "official", "operating", "particularly", "physical", "practice", "provider", "reports", "retained", "second", "structure".... | EXACT TITLE in childcare_family: "Salvation Army".
0.500
authoritiesauthoritybuildingbuildingsbusinesscapitalcommercialcontainingestatefarmfunctionshousingintendedinvestmentlandleastlevelslocalmaintainmedical
SHARED TOKENS (26): "authorities", "authority", "building", "buildings", "business", "capital", "commercial", "containing", "estate", "farm", "functions", "housing", "intended", "investment", "land", "least", "levels", "local", "maintain", "medical".... | EXACT TITLE in insurance_coverage: "Commercial property".
0.500
YMCA ↗ Q157169 EXACT TITLE
activitiesassociationdevelopmentfacilitiesindependentlocalnationalorganizationorganizationspracticeprogramsprovidingregionalstaffsubjectwork
SHARED TOKENS (16): "activities", "association", "development", "facilities", "independent", "local", "national", "organization", "organizations", "practice", "programs", "providing", "regional", "staff", "subject", "work". | EXACT TITLE in childcare_family: "YMCA".
0.500
Orphanage ↗ Q160645 EXACT TITLE
cannotcarecenturycommunitiescontroldescribedespeciallyfamiliesfamilyfundgenerallygrouphomehomesinstitutionslegaloperateparentpopulationrecruit
SHARED TOKENS (25): "cannot", "care", "century", "communities", "control", "described", "especially", "families", "family", "fund", "generally", "group", "home", "homes", "institutions", "legal", "operate", "parent", "population", "recruit".... | EXACT TITLE in childcare_family: "Orphanage".
0.500
clientscounselingdefineddevelopmentdirectespeciallyfamiliesfamilyindividualinfluencerelatedrelationshipsschoolsstudysupportsystemsystemsview
SHARED TOKENS (18): "clients", "counseling", "defined", "development", "direct", "especially", "families", "family", "individual", "influence", "related", "relationships", "schools", "study", "support", "system", "systems", "view". | EXACT TITLE in childcare_family: "Family therapy".
0.500
administrationcompensationdatadepartmentemployerexperienceheadquarteredhelpinformationinsurancelabornationaloperatesorganizationratereportedsupportssystemsworkers
SHARED TOKENS (19): "administration", "compensation", "data", "department", "employer", "experience", "headquartered", "help", "information", "insurance", "labor", "national", "operates", "organization", "rate", "reported", "supports", "systems", "workers". | EXACT TITLE in insurance_coverage: "National Council on Compensation Insurance".
0.500
amonganothercomprehensivecontrolcorporatedatadecisionsdesigndevelopmentengineeringeveneventsfinancefinancialhealthidentifyingindustrialinstitutionsinsurancelegal
SHARED TOKENS (39): "among", "another", "comprehensive", "control", "corporate", "data", "decisions", "design", "development", "engineering", "even", "events", "finance", "financial", "health", "identifying", "industrial", "institutions", "insurance", "legal".... | EXACT TITLE in insurance_coverage: "Risk management".
0.500
administeredagencyamongamountassociationbenefitbusinesscarecostscoveredcoveringdefineddisabilityemployerfinancehealthindividualindividualsinsurancemandatory
SHARED TOKENS (36): "administered", "agency", "among", "amount", "association", "benefit", "business", "care", "costs", "covered", "covering", "defined", "disability", "employer", "finance", "health", "individual", "individuals", "insurance", "mandatory".... | EXACT TITLE in insurance_coverage: "Health insurance".
0.500
Yelp ↗ Q2299611 EXACT TITLE
acquiredannualbusinessbusinessescomcomplaintsdirectoryenteredexpandedexternalheadquarteredhouseholdinformationmarchoperatespracticepracticespublicpublishedpublishes
SHARED TOKENS (23): "acquired", "annual", "business", "businesses", "com", "complaints", "directory", "entered", "expanded", "external", "headquartered", "household", "information", "march", "operates", "practice", "practices", "public", "published", "publishes".... | EXACT TITLE in insurance_coverage: "Yelp".
0.500
adequatechangescitiesconsequentlydefinitionexperiencefamilyformgenerallyhousingidentifyingindividualslegalprimaryprivatepublicstandardizedstatusworkyet
SHARED TOKENS (20): "adequate", "changes", "cities", "consequently", "definition", "experience", "family", "form", "generally", "housing", "identifying", "individuals", "legal", "primary", "private", "public", "standardized", "status", "work", "yet". | EXACT TITLE in childcare_family: "Homelessness".
0.500
acquiredcarecenturycollegecostscurriculumdescribeddevelopmenteducationeducationalentitiesfederalfoundationgoverningheldlevelsmunicipalparticularlypolicypractice
SHARED TOKENS (36): "acquired", "care", "century", "college", "costs", "curriculum", "described", "development", "education", "educational", "entities", "federal", "foundation", "governing", "held", "levels", "municipal", "particularly", "policy", "practice".... | EXACT TITLE in childcare_family: "Early childhood education".
0.500
carecentercommunitiescoordinationcoordinatoreducationeligibleexperiencefamiliesfamilyfederalfederallyhealthhomeinstructionlanguagelegislationlimitedlocallymedical
SHARED TOKENS (35): "care", "center", "communities", "coordination", "coordinator", "education", "eligible", "experience", "families", "family", "federal", "federally", "health", "home", "instruction", "language", "legislation", "limited", "locally", "medical".... | EXACT TITLE in childcare_family: "Early Head Start".
0.500
Title insurance ↗ EXACT TITLE
againstamountbusinesscommercialconstitutecostscoveredespeciallyestatefinancialfireformfoundgeneralgenerallyindependentinstitutionalinsurancelandlaw
SHARED TOKENS (39): "against", "amount", "business", "commercial", "constitute", "costs", "covered", "especially", "estate", "financial", "fire", "form", "found", "general", "generally", "independent", "institutional", "insurance", "land", "law".... | EXACT TITLE in insurance_coverage: "Title insurance".
0.500
Disability ↗ Q12131 EXACT TITLE
accessacquiredactivitiesactivityagainstcategoriesdefinesdisabilityexperiencehistoricallyhistoryidentityindividualindividualslanguagelawlegalmediamedicalmodel
SHARED TOKENS (33): "access", "acquired", "activities", "activity", "against", "categories", "defines", "disability", "experience", "historically", "history", "identity", "individual", "individuals", "language", "law", "legal", "media", "medical", "model".... | EXACT TITLE in childcare_family: "Disability". | EXACT TITLE in insurance_coverage: "Disability".
0.500
affectagainstamountcompensationcontractualcostcostscoveredespeciallyevenexpresslyfinancingfundgeneralgroupindividualinsurancelegalpolicyprotection
SHARED TOKENS (25): "affect", "against", "amount", "compensation", "contractual", "cost", "costs", "covered", "especially", "even", "expressly", "financing", "fund", "general", "group", "individual", "insurance", "legal", "policy", "protection".... | EXACT TITLE in insurance_coverage: "Liability insurance".
0.500
adaboisedepartmenteducationeducationalenrollmentheadquarteredidahopublicratesschoolssecondservessystemwestern
SHARED TOKENS (15): "ada", "boise", "department", "education", "educational", "enrollment", "headquartered", "idaho", "public", "rates", "schools", "second", "serves", "system", "western". | EXACT TITLE in childcare_family: "Boise School District".
0.500
Child care ↗ Q1455871 EXACT TITLE
accessactivitiesaffordableamountanothercarecommunitiesdevelopmenteconomiceducationeducationalessentialfamiliesfamilyformhomeshousinginstitutionslaborlicensed
SHARED TOKENS (34): "access", "activities", "affordable", "amount", "another", "care", "communities", "development", "economic", "education", "educational", "essential", "families", "family", "form", "homes", "housing", "institutions", "labor", "licensed".... | EXACT TITLE in childcare_family: "Child care".
0.500
administrationassistancebeganbenefitcreatesdepartmenteducationaleligiblefamiliesfederalhealthhomehoursjulyleastprogramprovideprovidingrequiredrequirements
SHARED TOKENS (24): "administration", "assistance", "began", "benefit", "creates", "department", "educational", "eligible", "families", "federal", "health", "home", "hours", "july", "least", "program", "provide", "providing", "required", "requirements".... | EXACT TITLE in childcare_family: "Temporary Assistance for Needy Families".
0.500
Contract ↗ Q93288 EXACT TITLE
activitiesagreementsbusinesscategorycodecommercialcontractscontractualdocumentdutiesenforcementgeneralgenerallygovernedindependentindividualsjurisdictionslawlegallegally
SHARED TOKENS (33): "activities", "agreements", "business", "category", "code", "commercial", "contracts", "contractual", "document", "duties", "enforcement", "general", "generally", "governed", "independent", "individuals", "jurisdictions", "law", "legal", "legally".... | EXACT TITLE in childcare_family: "Contract". | EXACT TITLE in insurance_coverage: "Contract".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
arrangementsbenefitbuildingbusinessbusinessescapitalcommercialconvertsdemanddescribeddirectlyestatefinancialformhomeindividualsinvestmentjurisdictionslawlegal
SHARED TOKENS (31): "arrangements", "benefit", "building", "business", "businesses", "capital", "commercial", "converts", "demand", "described", "directly", "estate", "financial", "form", "home", "individuals", "investment", "jurisdictions", "law", "legal".... | EXACT TITLE in insurance_coverage: "Mortgage".
0.500
administeredagencyagricultureassistancecommercialcommunitiescurrentdepartmentdirectlyfederalnationalprogramprogramsreportsresourcesserved
SHARED TOKENS (16): "administered", "agency", "agriculture", "assistance", "commercial", "communities", "current", "department", "directly", "federal", "national", "program", "programs", "reports", "resources", "served". | EXACT TITLE in insurance_coverage: "United States Department of Agriculture".
0.500
accessadditionalbenefitcurriculumeducationeducationalequipmentgeneralhelphigherindividualindividualslevelpersonalphysicalpracticeprovideresourceseparateserved
SHARED TOKENS (23): "access", "additional", "benefit", "curriculum", "education", "educational", "equipment", "general", "help", "higher", "individual", "individuals", "level", "personal", "physical", "practice", "provide", "resource", "separate", "served".... | EXACT TITLE in childcare_family: "Special education".
0.500
accessaddanotherassociationbusinessbusinessescarechannelclientscommercialcompensationcontroldirectdirectlydisabilitydistributionestateeventsfinancialfire
SHARED TOKENS (57): "access", "add", "another", "association", "business", "businesses", "care", "channel", "clients", "commercial", "compensation", "control", "direct", "directly", "disability", "distribution", "estate", "events", "financial", "fire".... | EXACT TITLE in insurance_coverage: "Independent insurance agent".
0.500
activitiesamongcompletecomprehensiveeducationemployeremploymenthistoryindividualindividualsprocesspurposerecordsearchsecurity
SHARED TOKENS (15): "activities", "among", "complete", "comprehensive", "education", "employer", "employment", "history", "individual", "individuals", "process", "purpose", "record", "search", "security". | EXACT TITLE in childcare_family: "Background check".
0.500
accessaffordableagencyanotheravailabilitybeyondcreatedevelopmenteconomicevenfamilygrowthhealthhigherhouseholdindividualindividualslandlegallevel
SHARED TOKENS (33): "access", "affordable", "agency", "another", "availability", "beyond", "create", "development", "economic", "even", "family", "growth", "health", "higher", "household", "individual", "individuals", "land", "legal", "level".... | EXACT TITLE in childcare_family: "Food security".
0.500
Franchising ↗ Q171947 EXACT TITLE
anotherbrandbusinesscapitalcorporatedirecteconomicespeciallyfeesfinancialgrowthindividualinvestmentlegallicenseslicensingmarketmodelobligationsowned
SHARED TOKENS (32): "another", "brand", "business", "capital", "corporate", "direct", "economic", "especially", "fees", "financial", "growth", "individual", "investment", "legal", "licenses", "licensing", "market", "model", "obligations", "owned".... | EXACT TITLE in childcare_family: "Franchising".
0.500
actcomprehensivecurrentdepartmenteducationestablishexpandedfamiliesfamilyfederalhealthnetworkoutsideparentphysicalprogramrelationshipsrequiringresourcesspace
SHARED TOKENS (21): "act", "comprehensive", "current", "department", "education", "establish", "expanded", "families", "family", "federal", "health", "network", "outside", "parent", "physical", "program", "relationships", "requiring", "resources", "space".... | EXACT TITLE in childcare_family: "Head Start (program)".
0.500
amountcareconsumercostcostscoveredcoveringeventsfirefrequentlygeneralhealthhigherhomehousinginsurancemultiplepaymentspolicyprograms
SHARED TOKENS (25): "amount", "care", "consumer", "cost", "costs", "covered", "covering", "events", "fire", "frequently", "general", "health", "higher", "home", "housing", "insurance", "multiple", "payments", "policy", "programs".... | EXACT TITLE in insurance_coverage: "Deductible".
0.500
actagenciesallowingbusinesscontractsdefinedfederalfoundgeneralidahoindependentindividualindustryinsurancejurisdictionslegallylimitedplacementpolicyregulatory
SHARED TOKENS (23): "act", "agencies", "allowing", "business", "contracts", "defined", "federal", "found", "general", "idaho", "independent", "individual", "industry", "insurance", "jurisdictions", "legally", "limited", "placement", "policy", "regulatory".... | EXACT TITLE in insurance_coverage: "Managing general agent".
0.500
amountbenefitbusinessentitiesfinancelocalmissionobtainoperatedoperatesoperationsorganizationorganizationsownersprivateprogrampublicpurposeratherreceive
SHARED TOKENS (23): "amount", "benefit", "business", "entities", "finance", "local", "mission", "obtain", "operated", "operates", "operations", "organization", "organizations", "owners", "private", "program", "public", "purpose", "rather", "receive".... | EXACT TITLE in childcare_family: "Nonprofit organization".
0.480
anotheraprilassetscapitalfinancialfundgrowthindustrialinvestmentmanagementpartnerprivatestructuredtechnology
SHARED TOKENS (14): "another", "april", "assets", "capital", "financial", "fund", "growth", "industrial", "investment", "management", "partner", "private", "structured", "technology". | EXACT TITLE in childcare_family: "Golden Gate Capital".
0.480
actaffordablearrangementscarecovereddefinedessentialhealthinsurancelawmarketsoutsidesubjectwelfare
SHARED TOKENS (14): "act", "affordable", "arrangements", "care", "covered", "defined", "essential", "health", "insurance", "law", "markets", "outside", "subject", "welfare". | EXACT TITLE in insurance_coverage: "Essential health benefits".
0.480
coordinationdevelopmentequipmentfacilitieshelpinstitutionsphysicalprovideprovidingpublicschoolsstructuressupportingtype
SHARED TOKENS (14): "coordination", "development", "equipment", "facilities", "help", "institutions", "physical", "provide", "providing", "public", "schools", "structures", "supporting", "type". | EXACT TITLE in childcare_family: "Playground".
0.480
Family ↗ Q8436 EXACT TITLE
categoriescreateeconomicfamiliesfamilygrouphistoricallyhistoryorganizationsprimarypurposerelatedrelationshipstructure
SHARED TOKENS (14): "categories", "create", "economic", "families", "family", "group", "historically", "history", "organizations", "primary", "purpose", "related", "relationship", "structure". | EXACT TITLE in childcare_family: "Family". | EXACT TITLE in insurance_coverage: "Family".
0.480
analysisbusinessdatadecisionsdescriptionguidemakingmanagementplanningpracticesquestionsrelatedreportingtherefore
SHARED TOKENS (14): "analysis", "business", "data", "decisions", "description", "guide", "making", "management", "planning", "practices", "questions", "related", "reporting", "therefore". | EXACT TITLE in insurance_coverage: "Business analytics".
0.480
actchoicedirectlyenrollmenthealthinsurancelabormedicaloperatorprivateproviderssecuritysystemstype
SHARED TOKENS (14): "act", "choice", "directly", "enrollment", "health", "insurance", "labor", "medical", "operator", "private", "providers", "security", "systems", "type". | EXACT TITLE in insurance_coverage: "Medicare Advantage".
0.480
Easement ↗ Q448405 EXACT TITLE
accessamonganotherjurisdictionslandlawlimitedownedpropertyprovidingpublicpurposerealtype
SHARED TOKENS (14): "access", "among", "another", "jurisdictions", "land", "law", "limited", "owned", "property", "providing", "public", "purpose", "real", "type". | EXACT TITLE in insurance_coverage: "Easement".
0.460
carecoordinationcourtsfirmsgeneralhealthindividualslawlegalmanagementmedicalsystemtreatment
SHARED TOKENS (13): "care", "coordination", "courts", "firms", "general", "health", "individuals", "law", "legal", "management", "medical", "system", "treatment". | EXACT TITLE in childcare_family: "Case management".
0.460
amongcarecosteducationevenexperiencefamilyhealthhealthcareindividualsinvestmentparticularlyplanning
SHARED TOKENS (13): "among", "care", "cost", "education", "even", "experience", "family", "health", "healthcare", "individuals", "investment", "particularly", "planning". | EXACT TITLE in childcare_family: "Maternal health".
0.440
businesscostsemployeeemployersknowledgemaintainorganizationrateretainretentiontrainingworkforce
SHARED TOKENS (12): "business", "costs", "employee", "employers", "knowledge", "maintain", "organization", "rate", "retain", "retention", "training", "workforce". | EXACT TITLE in childcare_family: "Employee retention".
0.440
Deed ↗ Q705914 EXACT TITLE
associateddocumentespeciallyjurisdictionslawlegallicensesownershippracticepropertytitletype
SHARED TOKENS (12): "associated", "document", "especially", "jurisdictions", "law", "legal", "licenses", "ownership", "practice", "property", "title", "type". | EXACT TITLE in childcare_family: "Deed". | EXACT TITLE in insurance_coverage: "Deed".
0.440
activitybusinessbusinessescategoriescategorycodedirectoryinformationmovedsearchsectiontype
SHARED TOKENS (12): "activity", "business", "businesses", "categories", "category", "code", "directory", "information", "moved", "search", "section", "type". | EXACT TITLE in insurance_coverage: "Business directory".
0.440
amongfinancialinstitutionsinsuranceinvestmentpracticepublicrisksecuritysupportingunderwritingvalue
SHARED TOKENS (12): "among", "financial", "institutions", "insurance", "investment", "practice", "public", "risk", "security", "supporting", "underwriting", "value". | EXACT TITLE in childcare_family: "Underwriting". | EXACT TITLE in insurance_coverage: "Underwriting".
0.420
Escrow ↗ Q338451 EXACT TITLE
accountcontractualestablishedheldinsuranceobligationsprimaryprincipalpropertyreceivestransaction
SHARED TOKENS (11): "account", "contractual", "established", "held", "insurance", "obligations", "primary", "principal", "property", "receives", "transaction". | EXACT TITLE in insurance_coverage: "Escrow".
0.400
Subrogation ↗ Q322457 EXACT TITLE
anotherbenefitinsurancejurisdictionslawlegalrelativelysecondsubjectsystems
SHARED TOKENS (10): "another", "benefit", "insurance", "jurisdictions", "law", "legal", "relatively", "second", "subject", "systems". | EXACT TITLE in insurance_coverage: "Subrogation".
0.400
caredemonstratedevelopmenteducationfamilygrowthhomeprofessionalprogramssupport
SHARED TOKENS (10): "care", "demonstrate", "development", "education", "family", "growth", "home", "professional", "programs", "support". | EXACT TITLE in childcare_family: "Child Development Associate".
0.380
businessformmaterialpracticesprivateprovidingpublicqualityrather
SHARED TOKENS (9): "business", "form", "material", "practices", "private", "providing", "public", "quality", "rather". | EXACT TITLE in childcare_family: "Philanthropy".
0.380
Lien ↗ Q4469383 EXACT TITLE
applicationbenefitformgenerallypropertyretainsecuritytypetypes
SHARED TOKENS (9): "application", "benefit", "form", "generally", "property", "retain", "security", "type", "types". | EXACT TITLE in childcare_family: "Lien". | EXACT TITLE in insurance_coverage: "Lien".
0.380
Workforce ↗ Q13440398 EXACT TITLE
cannotdefinedemploymentpopulationratetextworkworkforceworking
SHARED TOKENS (9): "cannot", "defined", "employment", "population", "rate", "text", "work", "workforce", "working". | EXACT TITLE in childcare_family: "Workforce". | EXACT TITLE in insurance_coverage: "Workforce".
0.380
activitiescenturyeducationeducationalhomeinstitutionsoutsidetransitionwhose
SHARED TOKENS (9): "activities", "century", "education", "educational", "home", "institutions", "outside", "transition", "whose". | EXACT TITLE in childcare_family: "Kindergarten".
0.380
formheldlawlimitedpersonalproductproductspropertypublic
SHARED TOKENS (9): "form", "held", "law", "limited", "personal", "product", "products", "property", "public". | EXACT TITLE in insurance_coverage: "Product liability".
0.380
againsteventsfirehomeinsurancepolicypropertyprotectionrequire
SHARED TOKENS (9): "against", "events", "fire", "home", "insurance", "policy", "property", "protection", "require". | EXACT TITLE in insurance_coverage: "Property insurance".
0.380
Prenatal care ↗ EXACT TITLE
availabilitycarechangesformhealthhealthcaremedicalparenttype
SHARED TOKENS (9): "availability", "care", "changes", "form", "health", "healthcare", "medical", "parent", "type". | EXACT TITLE in childcare_family: "Prenatal care".
0.360
activitiesbusinessesinformationinfrastructureinsuranceproductrisktechnology
SHARED TOKENS (8): "activities", "businesses", "information", "infrastructure", "insurance", "product", "risk", "technology". | EXACT TITLE in insurance_coverage: "Cyber insurance".
0.360
Reinsurance ↗ Q476118 EXACT TITLE
againstcapacitycostscountexchangeinsuranceissuedunderwriting
SHARED TOKENS (8): "against", "capacity", "costs", "count", "exchange", "insurance", "issued", "underwriting". | EXACT TITLE in insurance_coverage: "Reinsurance".
0.360
acquisitionbusinessdefinedentitiesfinancialgrouplargertreatment
SHARED TOKENS (8): "acquisition", "business", "defined", "entities", "financial", "group", "larger", "treatment". | EXACT TITLE in insurance_coverage: "Consolidation (business)".
0.360
educationenforcementengineeringfireknowledgepracticessurroundingthem
SHARED TOKENS (8): "education", "enforcement", "engineering", "fire", "knowledge", "practices", "surrounding", "them". | EXACT TITLE in childcare_family: "Fire prevention".
0.340
educationespeciallyfederallyorganizationsprivateprogramrole
SHARED TOKENS (7): "education", "especially", "federally", "organizations", "private", "program", "role". | EXACT TITLE in childcare_family: "Pre-kindergarten".
0.340
State Farm ↗ Q2007336 EXACT TITLE
corporatefarmgroupinsurancepropertyprovidersecond
SHARED TOKENS (7): "corporate", "farm", "group", "insurance", "property", "provider", "second". | EXACT TITLE in insurance_coverage: "State Farm".
0.320
applicableauthorizeslandpermituseszoning
SHARED TOKENS (6): "applicable", "authorizes", "land", "permit", "uses", "zoning". | EXACT TITLE in childcare_family: "Special-use permit".
0.320
Unemployment ↗ Q41171 EXACT TITLE
addedemploymentrateratherspecifiedwork
SHARED TOKENS (6): "added", "employment", "rate", "rather", "specified", "work". | EXACT TITLE in insurance_coverage: "Unemployment".
0.320
buildingscenturycitiesdevelopmentmaintainsproducts
SHARED TOKENS (6): "buildings", "century", "cities", "development", "maintains", "products". | EXACT TITLE in childcare_family: "Historic preservation".
0.320
Preschool ↗ Q1076052 EXACT TITLE
educationeducationaloperatedprimarypublicspace
SHARED TOKENS (6): "education", "educational", "operated", "primary", "public", "space". | EXACT TITLE in childcare_family: "Preschool".
0.300
activitiesassociatedcarecostscoveredgenerallyhealthhelphomeindividualsinsuranceleastoccurspercentproductrelativelyrequiretype
SHARED TOKENS (18): "activities", "associated", "care", "costs", "covered", "generally", "health", "help", "home", "individuals", "insurance", "least", "occurs", "percent", "product", "relatively", "require", "type".
0.300
againstcapitaleconomicevenexposurefinancefinancialgenerallyidentifyingindividualinvestmentlinemanagementmarketoperationalparticularlypracticeprincipallyraterelated
SHARED TOKENS (27): "against", "capital", "economic", "even", "exposure", "finance", "financial", "generally", "identifying", "individual", "investment", "line", "management", "market", "operational", "particularly", "practice", "principally", "rate", "related"....
0.300
Legal guardian ↗ Q157509 KW CROSS HIGH
anotherauthoritycannotcaredecisionsfamilyfoundhousingindividuallegalmakingmedicalpersonalprofessionalpropertypublicrelevant
SHARED TOKENS (17): "another", "authority", "cannot", "care", "decisions", "family", "found", "housing", "individual", "legal", "making", "medical", "personal", "professional", "property", "public", "relevant".
0.300
Life insurance ↗ Q626608 KW CROSS HIGH
benefitcapitalcategoriescontractsdefineddesignespeciallyeventsformgrowthindustryinsuranceinvestmentlegalmajormedicalphysicalpolicyproductproducts
SHARED TOKENS (25): "benefit", "capital", "categories", "contracts", "defined", "design", "especially", "events", "form", "growth", "industry", "insurance", "investment", "legal", "major", "medical", "physical", "policy", "product", "products"....
0.300
actadministrativecarecontractscorporatecoveredcreatedirectdisabilitydocumenteligibilityemployeeemployerfoundgrouphealthinsuranceobligationspolicyprovisions
SHARED TOKENS (22): "act", "administrative", "care", "contracts", "corporate", "covered", "create", "direct", "disability", "document", "eligibility", "employee", "employer", "found", "group", "health", "insurance", "obligations", "policy", "provisions"....
0.300
actamongaprilcodecontinuingdepartmentdisabilityemployeeemployersemploymentgenerallygrouphealthinsurancelawofficialpriceprivateprogrampublic
SHARED TOKENS (27): "act", "among", "april", "code", "continuing", "department", "disability", "employee", "employers", "employment", "generally", "group", "health", "insurance", "law", "official", "price", "private", "program", "public"....
0.300
carechangesdefinedhealthhospitalhoursleastmedicalorganizationorganizationsreportreportedsectionsystemtwelveusesyet
SHARED TOKENS (17): "care", "changes", "defined", "health", "hospital", "hours", "least", "medical", "organization", "organizations", "report", "reported", "section", "system", "twelve", "uses", "yet".
0.300
Adoption ↗ Q180472 KW CROSS HIGH
anothercarecenturycomprehensivecontractsformalgovernedgoverninghistoricallyintendedlegalparentprocessrequiresspecifiedstatussystems
SHARED TOKENS (17): "another", "care", "century", "comprehensive", "contracts", "formal", "governed", "governing", "historically", "intended", "legal", "parent", "process", "requires", "specified", "status", "systems".
0.300
anotherbegandescribeddirectlyeconomyfinalfreemakingmanagementmarketownedownershippositionproductproductsratherrelatedriversuppliesvertical
SHARED TOKENS (20): "another", "began", "described", "directly", "economy", "final", "free", "making", "management", "market", "owned", "ownership", "position", "product", "products", "rather", "related", "river", "supplies", "vertical".
0.300
activitiesactivityadministrationadministrativeagenciesanothercenturychangescontrolcourtsdecisionseconomiceducationenforcementexpandedgenerallygoverninginfluencelawlegal
SHARED TOKENS (28): "activities", "activity", "administration", "administrative", "agencies", "another", "century", "changes", "control", "courts", "decisions", "economic", "education", "enforcement", "expanded", "generally", "governing", "influence", "law", "legal"....
0.300
actaffordableagainstassistanceassociatedcannotcarecommercialcostscoveringdisabilityfederalfinancialformhealthindividualsinsurancelevelsmajormedical
SHARED TOKENS (39): "act", "affordable", "against", "assistance", "associated", "cannot", "care", "commercial", "costs", "covering", "disability", "federal", "financial", "form", "health", "individuals", "insurance", "levels", "major", "medical"....
0.300
amongamountcomplexitycostsdescribeddevelopmenteconomicentitiesestatefinancialidentifyjurisdictionslanguagelegalmodelsnationalprocesspropertyrealrequirements
SHARED TOKENS (24): "among", "amount", "complexity", "costs", "described", "development", "economic", "entities", "estate", "financial", "identify", "jurisdictions", "language", "legal", "models", "national", "process", "property", "real", "requirements"....
0.300
actadministrationagainstagenciesassetsauthoritybusinesschangescomplianceconsumercostsdataeconomicestablishedfederalfinancialfirmsgrowthinstitutionsjuly
SHARED TOKENS (35): "act", "administration", "against", "agencies", "assets", "authority", "business", "changes", "compliance", "consumer", "costs", "data", "economic", "established", "federal", "financial", "firms", "growth", "institutions", "july"....
0.300
amountanotherbuildingdatadependformhomehomesinsurancelargermanagementmerelyordinarypropertyratesresourcesriskstudytowardtype
SHARED TOKENS (21): "amount", "another", "building", "data", "depend", "form", "home", "homes", "insurance", "larger", "management", "merely", "ordinary", "property", "rates", "resources", "risk", "study", "toward", "type"....
0.300
Moral hazard ↗ Q44454 KW CROSS HIGH
actagencyanotherassociatedcostcostseconomicexposurefinancialhigherincreasesinformationinsuranceprincipalrisktransactiontype
SHARED TOKENS (17): "act", "agency", "another", "associated", "cost", "costs", "economic", "exposure", "financial", "higher", "increases", "information", "insurance", "principal", "risk", "transaction", "type".
0.300
Social work ↗ Q205398 KW CROSS HIGH
administrationadvocacyagenciesbegancenturycommunitiescounselingdefineddevelopmentdirectlyeducationfamiliesfamilygrouphealthindividualindividualsindustriallaborlarger
SHARED TOKENS (37): "administration", "advocacy", "agencies", "began", "century", "communities", "counseling", "defined", "development", "directly", "education", "families", "family", "group", "health", "individual", "individuals", "industrial", "labor", "larger"....
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
acquiredadditionalannouncedapplicationassistancebeganbusinessescitiesconsumerdatafoundlocalmarchorganizationsownersplanningplatformprogrampublicreport
SHARED TOKENS (26): "acquired", "additional", "announced", "application", "assistance", "began", "businesses", "cities", "consumer", "data", "found", "local", "march", "organizations", "owners", "planning", "platform", "program", "public", "report"....
0.300
anotherassociationbenefitbusinesscategoriescategorychoicecontrolcreatesdirectdirectlyestablishfinanceformgroupheldinsurancelicensedmaintainmanagement
SHARED TOKENS (25): "another", "association", "benefit", "business", "categories", "category", "choice", "control", "creates", "direct", "directly", "establish", "finance", "form", "group", "held", "insurance", "licensed", "maintain", "management"....
0.300
accessadministrationagencyaprilauthoritiesbuildingbusinessdepartmentdevelopmententitiesfederalhousingindividualsinfrastructurelocalmajormanagementoccurspersonnelprimary
SHARED TOKENS (29): "access", "administration", "agency", "april", "authorities", "building", "business", "department", "development", "entities", "federal", "housing", "individuals", "infrastructure", "local", "major", "management", "occurs", "personnel", "primary"....
0.300
acquisitionactactivityanotherassetsbusinesscapitalcontrolcorporatecreatedepartmentdescribeddirectentitiesfederalgovernedlawlegalmanagementmarket
SHARED TOKENS (37): "acquisition", "act", "activity", "another", "assets", "business", "capital", "control", "corporate", "create", "department", "described", "direct", "entities", "federal", "governed", "law", "legal", "management", "market"....
0.300
actagainstagencyamongauthoritycommercialemployeefederalfinancialfirmsformgroupinsuranceinvestmentlawlegislationmarketnovemberpdfregulate
SHARED TOKENS (23): "act", "against", "agency", "among", "authority", "commercial", "employee", "federal", "financial", "firms", "form", "group", "insurance", "investment", "law", "legislation", "market", "november", "pdf", "regulate"....
0.300
accountagreementsanalysisbusinesscomparisoncurrentdirectlyeconomyindustrymarketingpercentpriceproductproductssearchsitesvertical
SHARED TOKENS (17): "account", "agreements", "analysis", "business", "comparison", "current", "directly", "economy", "industry", "marketing", "percent", "price", "product", "products", "search", "sites", "vertical".
0.300
actaddressingamongdecisionsdepartmenteconomicemployeeexternalfinancialgrouphelpidentifiedindividualorganizationorganizationsparticularlyraterequireresourcesretention
SHARED TOKENS (23): "act", "addressing", "among", "decisions", "department", "economic", "employee", "external", "financial", "group", "help", "identified", "individual", "organization", "organizations", "particularly", "rate", "require", "resources", "retention"....
0.300
First aid ↗ Q133981 KW CROSS HIGH
assistanceassociatedcallcareequipmentexternalgenerallyguidancehealthhelpindividuallegislationlevelmandatorymedicalmoveprofessionalpublicregulationrelationship
SHARED TOKENS (27): "assistance", "associated", "call", "care", "equipment", "external", "generally", "guidance", "health", "help", "individual", "legislation", "level", "mandatory", "medical", "move", "professional", "public", "regulation", "relationship"....
0.300
againstinsuranceissuedpropertyrisk
SHARED TOKENS (5): "against", "insurance", "issued", "property", "risk". | EXACT TITLE in insurance_coverage: "Flood insurance".
0.300
actactivitiesaddressingassistancecentercomprehensivedatadefinitionestablishestablishedfederalfinancialidentifiesinformationlawlegislationnationalofficeprogramspublic
SHARED TOKENS (25): "act", "activities", "addressing", "assistance", "center", "comprehensive", "data", "definition", "establish", "established", "federal", "financial", "identifies", "information", "law", "legislation", "national", "office", "programs", "public"....
0.300
Actuary ↗ Q179985 KW CROSS HIGH
additionaladministrativeaffectanalysisbusinesscenturycompletecomplexitycostdatesdesigneducationfinancialinformationinsuranceknowledgelicensingmanagementmechanismsmultiple
SHARED TOKENS (33): "additional", "administrative", "affect", "analysis", "business", "century", "complete", "complexity", "cost", "dates", "design", "education", "financial", "information", "insurance", "knowledge", "licensing", "management", "mechanisms", "multiple"....
0.300
actadaagainstbusinesschangescostscovereddisabilityemployersfinalidentityindividualsjulylawnationalprotectionprovidepublicrequirementsrequires
SHARED TOKENS (20): "act", "ada", "against", "business", "changes", "costs", "covered", "disability", "employers", "final", "identity", "individuals", "july", "law", "national", "protection", "provide", "public", "requirements", "requires".
0.300
businessbusinessesconsultingeconomicemployersfinancingheadquarteredhealthinsuranceintermediaryinvestmentmanagementoperatingprofessionalprogramrisk
SHARED TOKENS (16): "business", "businesses", "consulting", "economic", "employers", "financing", "headquartered", "health", "insurance", "intermediary", "investment", "management", "operating", "professional", "program", "risk".
0.300
affectamongassociationcommunitiesdefineddefinesdevelopersdevelopmenteconomiceducationhigheridentityindividualsinstitutionslargerlocalmajorpositionspracticepractices
SHARED TOKENS (28): "affect", "among", "association", "communities", "defined", "defines", "developers", "development", "economic", "education", "higher", "identity", "individuals", "institutions", "larger", "local", "major", "positions", "practice", "practices"....
0.300
againstamountbenefitcoveredestateeventsfirefunctionsgenerallyhomeindividualinsuranceleastlimitedobtainpaymentsplanningpolicyprovideproviding
SHARED TOKENS (24): "against", "amount", "benefit", "covered", "estate", "events", "fire", "functions", "generally", "home", "individual", "insurance", "least", "limited", "obtain", "payments", "planning", "policy", "provide", "providing"....
0.300
actadministrationadministrativeagencycaredepartmentfacilitiesfederalfinancinggovhealthhealthcarehomehomesinsuranceoversightpartnershipprocessprogramprograms
SHARED TOKENS (25): "act", "administration", "administrative", "agency", "care", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "home", "homes", "insurance", "oversight", "partnership", "process", "program", "programs"....
0.300
actadditionalaffordableaprilbeganbusinessescareenrollmentexchangefederalhealthinsurancelawnovemberoperationalorganizationsparticipatingprivateprotectionsmall
SHARED TOKENS (22): "act", "additional", "affordable", "april", "began", "businesses", "care", "enrollment", "exchange", "federal", "health", "insurance", "law", "november", "operational", "organizations", "participating", "private", "protection", "small"....
0.300
acquisitionamongcenturychangesdevelopmenteducationalexpandedfunctionsidentityindividualinfluencelanguagemajorpersonalphysicalprocessesresearchstudysystems
SHARED TOKENS (19): "acquisition", "among", "century", "changes", "development", "educational", "expanded", "functions", "identity", "individual", "influence", "language", "major", "personal", "physical", "processes", "research", "study", "systems".
0.300
actadministrationagencyassistancecostsdepartmenteducationemploymentestablishedfederalhealthinspectionslaborlawmissionoutreachprovidingratesregulatorystandards
SHARED TOKENS (22): "act", "administration", "agency", "assistance", "costs", "department", "education", "employment", "established", "federal", "health", "inspections", "labor", "law", "mission", "outreach", "providing", "rates", "regulatory", "standards"....
0.300
Child neglect ↗ Q559562 KW CROSS HIGH
actadequatecaredecisionsdefiningdependsdirectdutieseducationalemploymentestablishedfederalformhealthhousinglawlegallegallyparticularlyphysical
SHARED TOKENS (25): "act", "adequate", "care", "decisions", "defining", "depends", "direct", "duties", "educational", "employment", "established", "federal", "form", "health", "housing", "law", "legal", "legally", "particularly", "physical"....
0.300
changescontactcontinuityexperienceinformationlegalmultiplenationalorganizationprocessprovideprovidersprovidingremainsupportssystemwelfare
SHARED TOKENS (17): "changes", "contact", "continuity", "experience", "information", "legal", "multiple", "national", "organization", "process", "provide", "providers", "providing", "remain", "supports", "system", "welfare".
0.300
actactivitiesadministrationadvocacyanalysisanotherassociatedcapacitycareclientscontactcontrolcreatecustomerdefineddefinitioneducationemployerfamilyhealth
SHARED TOKENS (42): "act", "activities", "administration", "advocacy", "analysis", "another", "associated", "capacity", "care", "clients", "contact", "control", "create", "customer", "defined", "definition", "education", "employer", "family", "health"....
0.300
actadministrationagencydepartmentemployeeestablishedlabormanagementofficeprogramprovisionsreportingsecuritytitlewelfare
SHARED TOKENS (15): "act", "administration", "agency", "department", "employee", "established", "labor", "management", "office", "program", "provisions", "reporting", "security", "title", "welfare".
0.300
activitiesadministrationbuildingdepartmentdepartmentsdirectlyeconomicemployersemploymentfederalgoverninghealthhistorylabormissionpurposereportsstandardsthemwage
SHARED TOKENS (22): "activities", "administration", "building", "department", "departments", "directly", "economic", "employers", "employment", "federal", "governing", "health", "history", "labor", "mission", "purpose", "reports", "standards", "them", "wage"....
0.300
Balance billing ↗ KW CROSS HIGH
administrativeamountcarecostcostscreatesfeeshealthcareincreasesinsurancemakingmarketmedicalnetworkpracticeproviderprovidersratesrathersubject
SHARED TOKENS (24): "administrative", "amount", "care", "cost", "costs", "creates", "fees", "healthcare", "increases", "insurance", "making", "market", "medical", "network", "practice", "provider", "providers", "rates", "rather", "subject"....
0.300
accessactamongassociatedbenefitcodecontainscourtsdepartmentemployeeenforcementestablishesfederalfinancialindustryinformationlaborlawparticularlyprivate
SHARED TOKENS (26): "access", "act", "among", "associated", "benefit", "code", "contains", "courts", "department", "employee", "enforcement", "establishes", "federal", "financial", "industry", "information", "labor", "law", "particularly", "private"....
0.300
annualaprilassetsbrandcannotcommercialcompensationcontractscurrentdisabilityfiregeneralgroupinsurancelegallegallylistlocalmultipleoperates
SHARED TOKENS (27): "annual", "april", "assets", "brand", "cannot", "commercial", "compensation", "contracts", "current", "disability", "fire", "general", "group", "insurance", "legal", "legally", "list", "local", "multiple", "operates"....
0.300
activitiesactivitybuildingcarecentercommercialeducationalexperiencefinalhigherorganizationsoutsideparticipatingpopulationprimaryprogramprogramsrelativelyresearchstandardized
SHARED TOKENS (24): "activities", "activity", "building", "care", "center", "commercial", "educational", "experience", "final", "higher", "organizations", "outside", "participating", "population", "primary", "program", "programs", "relatively", "research", "standardized"....
0.300
analysisbusinesschangesconstructiondemonstrateemploymentfinancefinancialhistoricallyidentifyinsuranceinvestmentmodelsnewsphysicalproductsprofessionalprogramspublishedreport
SHARED TOKENS (25): "analysis", "business", "changes", "construction", "demonstrate", "employment", "finance", "financial", "historically", "identify", "insurance", "investment", "models", "news", "physical", "products", "professional", "programs", "published", "report"....
0.300
addedamongbuildingcommercialconsultingemployeegroupindexinstitutionalinsuranceinvestmentlegallyoperationsprincipalreportedrisk
SHARED TOKENS (16): "added", "among", "building", "commercial", "consulting", "employee", "group", "index", "institutional", "insurance", "investment", "legally", "operations", "principal", "reported", "risk".
0.300
addedadditionalapplicablebusinessbusinessescomprehensivecovereddefinedfinancialinsurancejurisdictionsoperationsphysicalpolicypositionprimaryprocesspropertytypetypes
SHARED TOKENS (20): "added", "additional", "applicable", "business", "businesses", "comprehensive", "covered", "defined", "financial", "insurance", "jurisdictions", "operations", "physical", "policy", "position", "primary", "process", "property", "type", "types".
0.300
accesscreatescurriculumdatademonstratesdisabilitydocumentdocumentseducationeducationaleligibleexperiencefederalformfreegeneralhealthhelpidentifiedindividual
SHARED TOKENS (39): "access", "creates", "curriculum", "data", "demonstrates", "disability", "document", "documents", "education", "educational", "eligible", "experience", "federal", "form", "free", "general", "health", "help", "identified", "individual"....
0.300
applicableassistancecommunitiesdescribeddevelopmenteducationformalfoundinstitutionsknowledgemaintainpracticeprofessionalschoolsstudytechnicaltransferable
SHARED TOKENS (17): "applicable", "assistance", "communities", "described", "development", "education", "formal", "found", "institutions", "knowledge", "maintain", "practice", "professional", "schools", "study", "technical", "transferable".
0.300
accessadditionalanotherassociatedcarecontroldefinesdefinitioneducationalexperiencefacehealthhigherlaborlegallylevelsmedicaloccursorganizationoutside
SHARED TOKENS (25): "access", "additional", "another", "associated", "care", "control", "defines", "definition", "educational", "experience", "face", "health", "higher", "labor", "legally", "levels", "medical", "occurs", "organization", "outside"....
0.300
Surety ↗ Q748845 EXACT TITLE
againstamountfinanceprincipalsecond
SHARED TOKENS (5): "against", "amount", "finance", "principal", "second". | EXACT TITLE in insurance_coverage: "Surety".
0.300
actadministrativebusinessescarecoveredemployersentitiesfamiliesfamilyfederalgenerallygovernsgrouphealthhealthcareindividualsinformationinsurancelawlimited
SHARED TOKENS (29): "act", "administrative", "businesses", "care", "covered", "employers", "entities", "families", "family", "federal", "generally", "governs", "group", "health", "healthcare", "individuals", "information", "insurance", "law", "limited"....
0.300
Drought ↗ Q43059 KW CROSS HIGH
activityagricultureamountannualavailabilitycostsdirectlyeconomiceconomyexperiencehealthhistoryincreasesjulylargerlevelslocalpublicregionreport
SHARED TOKENS (25): "activity", "agriculture", "amount", "annual", "availability", "costs", "directly", "economic", "economy", "experience", "health", "history", "increases", "july", "larger", "levels", "local", "public", "region", "report"....
0.300
actadaanalysisannualcompensationdisabilityemploymentfamilyforminformationinsurancelaborlawmanagementmedicalnationalpracticesprofessionalratesrelated
SHARED TOKENS (24): "act", "ada", "analysis", "annual", "compensation", "disability", "employment", "family", "form", "information", "insurance", "labor", "law", "management", "medical", "national", "practices", "professional", "rates", "related"....
0.300
Fidelity bond ↗ Q884117 KW CROSS HIGH
additionalagainstagreementsanotherassetsbenefitbusinessemployerfinancialfireformgeneralindividualsinsuranceobligationsobtainpropertyprotectionspecified
SHARED TOKENS (19): "additional", "against", "agreements", "another", "assets", "benefit", "business", "employer", "financial", "fire", "form", "general", "individuals", "insurance", "obligations", "obtain", "property", "protection", "specified".
0.300
addressingadministereddepartmenteducationessentialfederalgeneralhealthhealthcaremattersmedicalmissionprimaryprivateprovidingpublicseparatesystemwelfare
SHARED TOKENS (19): "addressing", "administered", "department", "education", "essential", "federal", "general", "health", "healthcare", "matters", "medical", "mission", "primary", "private", "providing", "public", "separate", "system", "welfare".
0.300
completeemployerexchangeformalfoundlaborlevellicenseoccupationoutsideplacementpracticeprofessionalreachregulatedstudysystemtrainingworking
SHARED TOKENS (19): "complete", "employer", "exchange", "formal", "found", "labor", "level", "license", "occupation", "outside", "placement", "practice", "professional", "reach", "regulated", "study", "system", "training", "working".
0.300
codedevelopmentheadquarteredhealthlocalnetworkoperatesorganizationprogramsprovidingreachesregionalservessupporttitle
SHARED TOKENS (15): "code", "development", "headquartered", "health", "local", "network", "operates", "organization", "programs", "providing", "reaches", "regional", "serves", "support", "title".
0.300
againstbusinessesconsultingcostcostscovereddirectespeciallyfinancialformgeneralindividualsinsurancelawlegalmedicalpolicypracticeproductprofessional
SHARED TOKENS (22): "against", "businesses", "consulting", "cost", "costs", "covered", "direct", "especially", "financial", "form", "general", "individuals", "insurance", "law", "legal", "medical", "policy", "practice", "product", "professional"....
0.300
actadministeredassistancedisabilityeducationfederalfreegeneralindividualindividualsinformationlawleastlegislationlevelnationalparentpracticeprogramprograms
SHARED TOKENS (27): "act", "administered", "assistance", "disability", "education", "federal", "free", "general", "individual", "individuals", "information", "law", "least", "legislation", "level", "national", "parent", "practice", "program", "programs"....
0.300
actadditionalaffordableagainstagencyassistancecarecodecompliantdepartmentdutiesenforcementfederalfundgenerallyhistoryincreasesindividuallawoffice
SHARED TOKENS (35): "act", "additional", "affordable", "against", "agency", "assistance", "care", "code", "compliant", "department", "duties", "enforcement", "federal", "fund", "generally", "history", "increases", "individual", "law", "office"....
0.300
actadditionaladministeredcarecategoriescovereddepartmenteligibleemployeeemployeremployersfacefamilyhourslaborlawleastmajormedicalprovide
SHARED TOKENS (26): "act", "additional", "administered", "care", "categories", "covered", "department", "eligible", "employee", "employer", "employers", "face", "family", "hours", "labor", "law", "least", "major", "medical", "provide"....
0.300
Play therapy ↗ Q1542331 KW CROSS HIGH
accountcarecodesdevelopmentessentialgenerallyhealthindividualinstitutionsknowledgepersonalpracticeprocessprofessionalproviderelationshipspecialistssubjecttrainingtrusted
SHARED TOKENS (21): "account", "care", "codes", "development", "essential", "generally", "health", "individual", "institutions", "knowledge", "personal", "practice", "process", "professional", "provide", "relationship", "specialists", "subject", "training", "trusted"....
0.300
accountanalysisassociatedbroadercostcostsdatesdocumentationeventsexposurehelpidentifiesidentifyingincreasinglyindividualindustrialmanagementmarketprocessreview
SHARED TOKENS (22): "account", "analysis", "associated", "broader", "cost", "costs", "dates", "documentation", "events", "exposure", "help", "identifies", "identifying", "increasingly", "individual", "industrial", "management", "market", "process", "review"....
0.300
benefitcontractsdemandevenhigherinformationinsurancelargerlawmanagementmarketmarketsparticipatingpriceproductprovisionsqualityrelevantrisingrisk
SHARED TOKENS (22): "benefit", "contracts", "demand", "even", "higher", "information", "insurance", "larger", "law", "management", "market", "markets", "participating", "price", "product", "provisions", "quality", "relevant", "rising", "risk"....
0.300
amongcompensationdisabilityeconomicemployeeemployeremployersemploymentexchangeformgeneralgenerallyhealthinsurancejurisdictionslimitedmandatorymedicaloutsidepayments
SHARED TOKENS (27): "among", "compensation", "disability", "economic", "employee", "employer", "employers", "employment", "exchange", "form", "general", "generally", "health", "insurance", "jurisdictions", "limited", "mandatory", "medical", "outside", "payments"....
0.300
accessallowingarrangementsassociationauthoritiescoordinationcostsdefinitiondevelopmenteconomicestatefinancialfrequentlygeneralgeographichigherindustryinfrastructureintendedinvestment
SHARED TOKENS (48): "access", "allowing", "arrangements", "association", "authorities", "coordination", "costs", "definition", "development", "economic", "estate", "financial", "frequently", "general", "geographic", "higher", "industry", "infrastructure", "intended", "investment"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
activitiesagenciescanyoncenturychannelcommercialconstructioncontrolcoveredhistoryidaholimitedmajornationalnorthpolicyprivateproductprogramspublic
SHARED TOKENS (27): "activities", "agencies", "canyon", "century", "channel", "commercial", "construction", "control", "covered", "history", "idaho", "limited", "major", "national", "north", "policy", "private", "product", "programs", "public"....
0.300
againstassociatedbroadercapacitycostscoveredinsurancelegalmanagementorganizationpersonalregulatoryreimbursementsimultaneouslytype
SHARED TOKENS (15): "against", "associated", "broader", "capacity", "costs", "covered", "insurance", "legal", "management", "organization", "personal", "regulatory", "reimbursement", "simultaneously", "type".
0.300
affordabilityagainstamongauthorityavailabilitybegancitiesconstructioneconomiceconomyhomeshousinglandlocalmajoroperatingownedplanningpropertypublic
SHARED TOKENS (26): "affordability", "against", "among", "authority", "availability", "began", "cities", "construction", "economic", "economy", "homes", "housing", "land", "local", "major", "operating", "owned", "planning", "property", "public"....
0.300
businessbusinessescommercialcovereddutiesgeneralgenerallyinsurancelinemarketmedicaloperationspaymentspersonalpolicyproductprofessionalpropertypublicseparate
SHARED TOKENS (22): "business", "businesses", "commercial", "covered", "duties", "general", "generally", "insurance", "line", "market", "medical", "operations", "payments", "personal", "policy", "product", "professional", "property", "public", "separate"....
0.300
accountactactivityamountapplicationbenefitcompensationcostfederalhealthinsuranceobtainoccursorganizationsprocessproviderreceivesystemsthemworkers
SHARED TOKENS (20): "account", "act", "activity", "amount", "application", "benefit", "compensation", "cost", "federal", "health", "insurance", "obtain", "occurs", "organizations", "process", "provider", "receive", "systems", "them", "workers".
0.300
Respite care ↗ Q7315937 KW CROSS HIGH
amongcaredescribeddisabilityexperiencefamiliesfamilyfinancialfundhealthhealthcarehelphomemaintainpercentpersonalphysicalprimaryprogramsprovide
SHARED TOKENS (27): "among", "care", "described", "disability", "experience", "families", "family", "financial", "fund", "health", "healthcare", "help", "home", "maintain", "percent", "personal", "physical", "primary", "programs", "provide"....
0.300
administeredadministrativeaffordableagenciesagencyassistanceauthoritybuildingsdepartmentdevelopmentdirectlyexchangefamiliesformgenerallyhomehousingindividuallocalnational
SHARED TOKENS (32): "administered", "administrative", "affordable", "agencies", "agency", "assistance", "authority", "buildings", "department", "development", "directly", "exchange", "families", "form", "generally", "home", "housing", "individual", "local", "national"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
approvedauthoritybeganbuildingbuildingscodecodescomplianceconstructioncontroldepartmentsdesigndevelopersestategeneralgenerallyhealthinsuranceintendedlaw
SHARED TOKENS (42): "approved", "authority", "began", "building", "buildings", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "estate", "general", "generally", "health", "insurance", "intended", "law"....
0.300
additionalagainstcombinesestatefinancialhomeindustryinsurancepersonalpolicyprivatepropertyprotectionrealtype
SHARED TOKENS (15): "additional", "against", "combines", "estate", "financial", "home", "industry", "insurance", "personal", "policy", "private", "property", "protection", "real", "type".
0.300
actadministeredadministrationagenciesappearcurrentdepartmentdepartmentsdutiesestablishedfederalfinancefinancialinstitutionslicenseslimitedmajormattersnationaloffice
SHARED TOKENS (24): "act", "administered", "administration", "agencies", "appear", "current", "department", "departments", "duties", "established", "federal", "finance", "financial", "institutions", "licenses", "limited", "major", "matters", "national", "office"....
0.300
agencyamountauthoritybenefitbusinessesconstructioncontractsdirecteconomiceconomygroupgrowthlocalorganizationorganizationspracticesprivateprocessprocurementpublic
SHARED TOKENS (30): "agency", "amount", "authority", "benefit", "businesses", "construction", "contracts", "direct", "economic", "economy", "group", "growth", "local", "organization", "organizations", "practices", "private", "process", "procurement", "public"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorychangescontroldescribeddevelopmentfinancefinancialfinancingfirmsfundgeneralinvestmentlimitedmanagementoperationalownershipprivateproduct
SHARED TOKENS (26): "business", "capital", "category", "changes", "control", "described", "development", "finance", "financial", "financing", "firms", "fund", "general", "investment", "limited", "management", "operational", "ownership", "private", "product"....
0.300
actapprovalsapprovedbuildingcommercialconstructioncostscreatesdefineddesigndevelopersdevelopmenteconomicestateexchangefinancialfinancinggrowthhousingland
SHARED TOKENS (36): "act", "approvals", "approved", "building", "commercial", "construction", "costs", "creates", "defined", "design", "developers", "development", "economic", "estate", "exchange", "financial", "financing", "growth", "housing", "land"....
0.300
actannualbenefitcareemployeremployersentitiesexchangefederallygrouphealthhealthcareindividualsinsurancemedicalorganizationproviderprovidersrequiredstatus
SHARED TOKENS (20): "act", "annual", "benefit", "care", "employer", "employers", "entities", "exchange", "federally", "group", "health", "healthcare", "individuals", "insurance", "medical", "organization", "provider", "providers", "required", "status".
🫐 BERRY70 edges
0.290
assetsbusinesscapitalgrouphealthmanagementprivate
SHARED TOKENS (7): "assets", "business", "capital", "group", "health", "management", "private". | URL->A (1): https://www.roarkcapital.com/portfolio.
0.280
documentdocumentationdocumentsidentifylawofficeownersownershippropertyrecordregistryservestitletransfers
SHARED TOKENS (14): "document", "documentation", "documents", "identify", "law", "office", "owners", "ownership", "property", "record", "registry", "serves", "title", "transfers".
0.280
Aon plc ↗ Q739518 KW CROSS HIGH
capitalcenterconsultinggroupheadquarteredhealthinsurancemanagementnorthoperatesoperationsprofessionalrelatedrisk
SHARED TOKENS (14): "capital", "center", "consulting", "group", "headquartered", "health", "insurance", "management", "north", "operates", "operations", "professional", "related", "risk".
0.280
accountcontractualcostcurrentevenfeesfinancialindexinsurancepaymentspolicyratetypevalue
SHARED TOKENS (14): "account", "contractual", "cost", "current", "even", "fees", "financial", "index", "insurance", "payments", "policy", "rate", "type", "value".
0.280
Child abuse ↗ Q167191 KW CROSS HIGH
actcommunitiesespeciallyfamilieshomejurisdictionsmandatoryorganizationsparentphysicalreportingrequirementsschoolstherefore
SHARED TOKENS (14): "act", "communities", "especially", "families", "home", "jurisdictions", "mandatory", "organizations", "parent", "physical", "reporting", "requirements", "schools", "therefore".
0.280
activityadministrationassociationcurrentgeneralleastmaintainprovidepurposerateratherrequiressubjecttreatment
SHARED TOKENS (14): "activity", "administration", "association", "current", "general", "least", "maintain", "provide", "purpose", "rate", "rather", "requires", "subject", "treatment".
0.280
communitiesdevelopmenteducationalfamilieslimitedmissionphysicalreceiveresourcesrisksupportsupportssystemthem
SHARED TOKENS (14): "communities", "development", "educational", "families", "limited", "mission", "physical", "receive", "resources", "risk", "support", "supports", "system", "them".
0.280
boisebrandconsumerdatademandidahomajormarketownedproductsreachservedsouthtechnology
SHARED TOKENS (14): "boise", "brand", "consumer", "data", "demand", "idaho", "major", "market", "owned", "products", "reach", "served", "south", "technology".
0.280
healthinsurancemanagementprocess
SHARED TOKENS (4): "health", "insurance", "management", "process". | EXACT TITLE in insurance_coverage: "Prior authorization".
0.280
capitalconsumerpartnersprivate
SHARED TOKENS (4): "capital", "consumer", "partners", "private". | EXACT TITLE in childcare_family: "Sycamore Partners".
0.280
Kinship care ↗ Q5595400 KW CROSS HIGH
carecommunitiesexperiencefamiliesfamilyformalhomelegalmaintainplacementrelatedrelationshipschoolssystem
SHARED TOKENS (14): "care", "communities", "experience", "families", "family", "formal", "home", "legal", "maintain", "placement", "related", "relationship", "schools", "system".
0.280
againstdefineddirectlyformfoundhealthindividualindividualsinsurancemedicalorganizationpolicypropertyrisk
SHARED TOKENS (14): "against", "defined", "directly", "form", "found", "health", "individual", "individuals", "insurance", "medical", "organization", "policy", "property", "risk".
0.280
Boise River ↗ Q891080 EXACT TITLE
boiseidahoriverwestern
SHARED TOKENS (4): "boise", "idaho", "river", "western". | EXACT TITLE in insurance_coverage: "Boise River".
0.260
associationinsuranceorganizations
SHARED TOKENS (3): "association", "insurance", "organizations". | EXACT TITLE in insurance_coverage: "Guaranty association".
0.260
documentsespeciallyestatemaintainsofficeownershippositionpropertyprovidepublicrealrecordsregistry
SHARED TOKENS (13): "documents", "especially", "estate", "maintains", "office", "ownership", "position", "property", "provide", "public", "real", "records", "registry".
0.260
Medigap ↗ Q6806864 KW CROSS HIGH
amountassociationcareequipmenthealthhomehospitalinsurancemedicalprivateprovidersrelatedreport
SHARED TOKENS (13): "amount", "association", "care", "equipment", "health", "home", "hospital", "insurance", "medical", "private", "providers", "related", "report".
0.260
administrationagencyagriculturedepartmentfarmhomemarketingnationalnetworkpolicyprogramsreportsstaff
SHARED TOKENS (13): "administration", "agency", "agriculture", "department", "farm", "home", "marketing", "national", "network", "policy", "programs", "reports", "staff".
0.260
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingbuildingscodesconstructiondepartmentfireincreasesinspectionsintendedoccurspracticesschoolsstructures
SHARED TOKENS (13): "building", "buildings", "codes", "construction", "department", "fire", "increases", "inspections", "intended", "occurs", "practices", "schools", "structures".
0.260
againstinsurancerelated
SHARED TOKENS (3): "against", "insurance", "related". | EXACT TITLE in insurance_coverage: "Crop insurance".
0.260
againstcreatesdisabilityformfunctionsinsurancemaintainphysicalprotectionprovidingriskworkworking
SHARED TOKENS (13): "against", "creates", "disability", "form", "functions", "insurance", "maintain", "physical", "protection", "providing", "risk", "work", "working".
0.260
againstbuildingbuildingsconstructioncoveredequipmentinsuranceorganizationphysicalpropertyriskstructuretype
SHARED TOKENS (13): "against", "building", "buildings", "construction", "covered", "equipment", "insurance", "organization", "physical", "property", "risk", "structure", "type".
0.240
careclientshealthinsurancemedicalorganizationparticipatingprovideproviderprovidersratestype
SHARED TOKENS (12): "care", "clients", "health", "insurance", "medical", "organization", "participating", "provide", "provider", "providers", "rates", "type".
0.240
amongcompensationfinancialforminsurancemarketoperationalownedpolicyratherretainedrisk
SHARED TOKENS (12): "among", "compensation", "financial", "form", "insurance", "market", "operational", "owned", "policy", "rather", "retained", "risk".
0.240
categoryconstructiondefinitionequipmenthistoricallyinsurancemedicalpropertyrelatedtransportationtypetypes
SHARED TOKENS (12): "category", "construction", "definition", "equipment", "historically", "insurance", "medical", "property", "related", "transportation", "type", "types".
0.240
additionalagenciescaredisabilityfamilyhealthhomeindividualinstitutionalratherrequiredsupport
SHARED TOKENS (12): "additional", "agencies", "care", "disability", "family", "health", "home", "individual", "institutional", "rather", "required", "support".
0.240
Request for proposal ↗ KW CROSS HIGH
businesscontractscustomerdocumentfinalforminformationpriceprocessprocurementproductquality
SHARED TOKENS (12): "business", "contracts", "customer", "document", "final", "form", "information", "price", "process", "procurement", "product", "quality".
0.220
actassociationauthoritybusinessfederalindustryinsurancelawlimitedregulateregulation
SHARED TOKENS (11): "act", "association", "authority", "business", "federal", "industry", "insurance", "law", "limited", "regulate", "regulation".
0.220
againsteventsfinancialinsurancelegalphysicalprimaryprotectionprovideregiontraffic
SHARED TOKENS (11): "against", "events", "financial", "insurance", "legal", "physical", "primary", "protection", "provide", "region", "traffic".
0.220
benefitdirectestablishedfinancialhomesinsurancelegalmajorownershippracticerelationship
SHARED TOKENS (11): "benefit", "direct", "established", "financial", "homes", "insurance", "legal", "major", "ownership", "practice", "relationship".
0.220
applicationdigitalestablishedfinancefinancialfirmsindustryplatformsproductssystemstechnology
SHARED TOKENS (11): "application", "digital", "established", "finance", "financial", "firms", "industry", "platforms", "products", "systems", "technology".
0.220
agencycodecoveringhomeinsurancejurisdictionsofficeseparatestandardssystemtype
SHARED TOKENS (11): "agency", "code", "covering", "home", "insurance", "jurisdictions", "office", "separate", "standards", "system", "type".
0.220
benefitcategoryhigherinsurancelimitedordinarypolicyremainrepresentsrequiredvalue
SHARED TOKENS (11): "benefit", "category", "higher", "insurance", "limited", "ordinary", "policy", "remain", "represents", "required", "value".
0.220
actcreatesemployeremploymenthourslaborlawlegislationstandardswagework
SHARED TOKENS (11): "act", "creates", "employer", "employment", "hours", "labor", "law", "legislation", "standards", "wage", "work".
0.220
agencyagriculturedepartmententitiesfederalinsurancemanagementownedprogramprotectionrisk
SHARED TOKENS (11): "agency", "agriculture", "department", "entities", "federal", "insurance", "management", "owned", "program", "protection", "risk".
0.210
idaho
SHARED TOKENS (1): "idaho". | EXACT TITLE in childcare_family: "Frank R. Gooding".
0.200
eligiblegrouplistlocallymissionorganizationorganizationsstafftypewhose
SHARED TOKENS (10): "eligible", "group", "list", "locally", "mission", "organization", "organizations", "staff", "type", "whose".
0.200
actamountcoveredextendsformindividualinsurancepolicyprimarytype
SHARED TOKENS (10): "act", "amount", "covered", "extends", "form", "individual", "insurance", "policy", "primary", "type".
0.200
boisedataevenfoundidahonorthpopulationresidentssinglesouth
SHARED TOKENS (10): "boise", "data", "even", "found", "idaho", "north", "population", "residents", "single", "south".
0.200
allowingcustomerfamilyinfluenceinformationmarketingprimaryprocessreferraltype
SHARED TOKENS (10): "allowing", "customer", "family", "influence", "information", "marketing", "primary", "process", "referral", "type".
0.200
commercialfamilyheadquarteredhealthinsuranceinvestmentprivateproductspropertyreported
SHARED TOKENS (10): "commercial", "family", "headquartered", "health", "insurance", "investment", "private", "products", "property", "reported".
0.200
actcarecommunitiesfamiliesfederalgovernslawnovemberplacementwelfare
SHARED TOKENS (10): "act", "care", "communities", "families", "federal", "governs", "law", "november", "placement", "welfare".
0.200
businessesfinancialfiregrouphomesindependentinsuranceownedproductssmall
SHARED TOKENS (10): "businesses", "financial", "fire", "group", "homes", "independent", "insurance", "owned", "products", "small".
0.180
commercialindependentindustrialinsurancelistofficeoperationspersonalproperty
SHARED TOKENS (9): "commercial", "independent", "industrial", "insurance", "list", "office", "operations", "personal", "property".
0.180
disabilitylawlegallymandatoryreportreportingrequiredrisksubject
SHARED TOKENS (9): "disability", "law", "legally", "mandatory", "report", "reporting", "required", "risk", "subject".
0.180
commercialheadquarteredhomeinsurancelistpersonalprivatetypeswater
SHARED TOKENS (9): "commercial", "headquartered", "home", "insurance", "list", "personal", "private", "types", "water".
0.180
Insurance law ↗ Q1037642 KW CROSS HIGH
businesscategoriesconsumerespeciallyinsurancelawpracticeregulationsurrounding
SHARED TOKENS (9): "business", "categories", "consumer", "especially", "insurance", "law", "practice", "regulation", "surrounding".
0.180
actdevelopmentfederalhousinginsurancelawnationalprogramtitle
SHARED TOKENS (9): "act", "development", "federal", "housing", "insurance", "law", "national", "program", "title".
0.180
exchangefinancialgroupinsurancelistoperatesownedpublicregional
SHARED TOKENS (9): "exchange", "financial", "group", "insurance", "list", "operates", "owned", "public", "regional".
0.180
Pediatrics ↗ Q123028 KW CROSS HIGH
caregeneralinsurancemedicalpracticerequiresresearchresourceswork
SHARED TOKENS (9): "care", "general", "insurance", "medical", "practice", "requires", "research", "resources", "work".
0.160
adaboisecenturyidahomunicipalpopulationsecondseparate
SHARED TOKENS (8): "ada", "boise", "century", "idaho", "municipal", "population", "second", "separate".
0.160
Volunteering ↗ Q188844 KW CROSS HIGH
acteducationgroupindividuallaborprovidetrainingwork
SHARED TOKENS (8): "act", "education", "group", "individual", "labor", "provide", "training", "work".
0.160
coveringeducationgeneralindividualparentprogramprogramstraining
SHARED TOKENS (8): "covering", "education", "general", "individual", "parent", "program", "programs", "training".
0.160
activityhealthlandpublicrisktransitionwildfirezone
SHARED TOKENS (8): "activity", "health", "land", "public", "risk", "transition", "wildfire", "zone".
0.160
eventshistoryindependentinsurancelawsinglesmallvalue
SHARED TOKENS (8): "events", "history", "independent", "insurance", "law", "single", "small", "value".
0.160
Allstate ↗ Q2645636 KW CROSS HIGH
headquarteredindependentinsurancelinelistoperationsownedpersonal
SHARED TOKENS (8): "headquartered", "independent", "insurance", "line", "list", "operations", "owned", "personal".
0.160
contractsfactsformgovernsinsurancelegalmakingmaterial
SHARED TOKENS (8): "contracts", "facts", "form", "governs", "insurance", "legal", "making", "material".
0.140
Kuna, Idaho ↗ KW CROSS HIGH
adaadditionalboiseidahokunapercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "percent", "population".
0.140
caldwellcanyonextendsheadquarteredidaholandnampa
SHARED TOKENS (7): "caldwell", "canyon", "extends", "headquartered", "idaho", "land", "nampa".
0.120
Single parent ↗ Q1204559 KW CROSS HIGH
familyhouseholdparentpartnersinglesupport
SHARED TOKENS (6): "family", "household", "parent", "partner", "single", "support".
0.120
arrangementsbusinesscompensationmanagementpublicregulation
SHARED TOKENS (6): "arrangements", "business", "compensation", "management", "public", "regulation".
0.120
associationheadquarteredindependentinsurancenationalorganization
SHARED TOKENS (6): "association", "headquartered", "independent", "insurance", "national", "organization".
0.120
insuranceparticularlypolicyprivatepublictype
SHARED TOKENS (6): "insurance", "particularly", "policy", "private", "public", "type".
0.120
amongcompensationinsurancemanagementriskworkers
SHARED TOKENS (6): "among", "compensation", "insurance", "management", "risk", "workers".
0.120
actapprovedfamilieslawnovemberpublic
SHARED TOKENS (6): "act", "approved", "families", "law", "november", "public".
0.120
associatedcarecostsformhealthinsurance
SHARED TOKENS (6): "associated", "care", "costs", "form", "health", "insurance".
0.100
activitieseducationgrouppracticesprograms
SHARED TOKENS (5): "activities", "education", "group", "practices", "programs".
0.100
developmentfamiliesinfluencepopulationtreatment
SHARED TOKENS (5): "development", "families", "influence", "population", "treatment".
0.100
Payment bond ↗ Q7156776 KW CROSS HIGH
contractsfederalmaterialrequiredvalue
SHARED TOKENS (5): "contracts", "federal", "material", "required", "value".
0.100
buildingcourtsdecisionsidahomoved
SHARED TOKENS (5): "building", "courts", "decisions", "idaho", "moved".
0.100
compensationinsuranceintermediarymultiplerepresents
SHARED TOKENS (5): "compensation", "insurance", "intermediary", "multiple", "represents".
◈ Frequently Asked Questions
Childcare Family × Insurance Coverage — Treasure Valley
HAIKU · HIGH GATE
Does Idaho Medicaid cover childcare expenses for families in the Boise metropolitan area?
Idaho Medicaid provides coverage for eligible childcare services under the Social Security Act framework, which applies to working families throughout Ada County and the greater Treasure Valley. Families in Boise, Nampa, and Meridian should verify their specific eligibility through Idaho's state Medicaid program, as coverage depends on income thresholds and employment status.
What insurance options do childcare providers in Nampa and Meridian need to maintain?
Childcare facilities in Nampa and Meridian must comply with Idaho occupational licensing requirements, which mandate specific liability and property insurance coverage. Trinity Health and other Treasure Valley insurers offer policies designed for childcare providers that meet Idaho's state regulatory standards.
Can parents in the Treasure Valley use online marketplaces to compare childcare insurance coverage options?
Parents across the Boise metropolitan area increasingly use online marketplaces to research childcare providers' insurance credentials and coverage details. Idaho's occupational licensing board maintains public records on Boise, Nampa, and Meridian childcare facilities, allowing families to verify insurance compliance before enrollment.
How does College of Western Idaho's continuing education program address childcare insurance requirements?
College of Western Idaho offers continuing education courses that train childcare professionals on insurance compliance and liability management specific to Idaho regulations. These programs help providers throughout the Treasure Valley understand coverage obligations under state law and occupational licensing standards.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Childcare Family × Insurance Coverage 21 QID bridges 261 edges 6,639 ext links 2026-07-17 19:51:03 UTC f3ebadeb0c5e7f40
Childcare Family corridor ↗ Insurance Coverage corridor ↗ Insurance Coverage × Childcare Family ↗ boisestandard.org/standard ↗
Parent Corridors
Childcare Family × All Other Verticals