—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Basque Culture ↔ relates to ↔ Biotech Life Sciences

11 Wikipedia bridge articles confirmed in both vertical ledgers. 257 deterministic cross-vertical edges. 7,030 external source links harvested. Every edge provenance-stamped. Every claim auditable.

11 QID Bridge Articles
257 Cross Edges
7,030 External Sources
280 Wikipedia Articles
11 🌲 Evergreen
182 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Basque Culture
× Biotech Life Sciences
QID Bridge Articles
11
confirmed Wikipedia overlap
Total Cross Edges
257
External Sources Harvested
7,030
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  29 shared tokens
QID Bridge Titles (11)
IdahoTreasure ValleyBoise State UniversityFood and Drug AdministrationBoise metropolitan areaBoise, IdahoIdaho State UniversityPrivate equityAda County, IdahoCaldwell, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationcapitalpublicnorthwestproductstreasurevalleyadacanyonagriculturalapproximatelyassociatedeasternlandtechnologywesternlocalactivity
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:34:06 UTC
Content Hash
0b91a01ee506e8a5
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
11 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in basque_culture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (29): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "distinct", "early", "eastern", "economy", "geographic", "idaho", "isolated", "land", "methods", "national", "northwest", "official", "organized", "people".... | EXACT TITLE in basque_culture: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
agriculturalagricultureapproximatelyassociatedboisecapitaldistinctearlyeasterneconomygeographicidahoisolatedlandmethodsnationalnorthwestofficialorganizedpeoplepopulationproductsscienceseparatesignificantsmallsuppliestechnologywestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in basque_culture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (15): "agricultural", "association", "boise", "commerce", "eastern", "historically", "idaho", "land", "local", "opportunities", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in basque_culture: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
agriculturalassociationboisecommerceeasternhistoricallyidaholandlocalopportunitiesregionresourcestreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in basque_culture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "college", "education", "engineering", "graduate", "health", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research", "school", "universities", "university". | EXACT TITLE in basque_culture: "Boise State University". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityamongboisebusinesscollegeeducationengineeringgraduatehealthidahoindependentinstitutionprogramprogramspublicreportedresearchschooluniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Food and Drug Administration
Q204711 EXACT TITLE 1.000
QID OVERLAP: Q204711 in basque_culture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (22): "act", "administration", "associated", "authority", "control", "current", "department", "directly", "employees", "federal", "field", "food", "health", "medical", "products", "public", "regulated", "related", "reports", "safety".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
actadministrationassociatedauthoritycontrolcurrentdepartmentdirectlyemployeesfederalfieldfoodhealthmedicalproductspublicregulatedrelatedreportssafetysectionwork
medical devices, electromagnetic radiation emitting devices (ERED), cosmetics, animal foods & feed, and veterinary products. The FDA's primary focus is enforcing the Federal Food, Drug, and Cosmetic Act (FD&C). However, the agency also enforces other laws, notably Section 361 of the Public Health Service Act as well as associated regulations. Much of this regulatory-enforcement work is not directly related to food or drugs but involves other regulated products like lasers, cellular phones, and condoms. In addition, the FDA uses its authority to mitigate diseases in a variety of contexts, from household pets to human sperm for use in assisted reproduction. The FDA is led by the commissioner of food and drugs, who is appointed by the president with the advice and consent of the Senate. The commissioner reports to the secretary of health and human services. Marty Makary is the current commissioner. The FDA's headquarters is located in the White Oak area of Silver Spring, Maryland, occupying the former Naval Ordnance Laboratory. The agency has 223 field offices and 13 laboratories located across the 50 states, the United States Virgin Islands, and Puerto Rico. In 2008, the FDA began to post employees to foreign countries, including China, India, Costa Rica, Chile, Belgium, and the United Kingdom.
White Oak Federal Research Center Since 1990, the FDA has had employees and facilities on 130 acres (53 hectares) of the White Oak Federal Research Center in the White Oak area of Silver Spring, Maryland. In 2001, the General Services Administration (GSA) began new construction on the campus to consolidate the FDA's 25 existing operations in the Washington metropolitan area, its headquarters in Rockville, and several fragmented office buildings. The first building, the Life Sciences Laboratory, was dedicated and opened with 104 employees in December 2003. As of December 2018, the FDA campus has a population of 10,987 employees housed in approximately 3,800,000 square feet (350,000 square metres) of space, divided into ten offices and four laboratory buildings. The campus houses the Office of the Commissioner (OC), the Office of Regulatory Affairs (ORA), the Center for Drug Evaluation and Research (CDER), the Center for Devices and Radiological Health (CDRH), the Center for Biologics Evaluation and Research (CBER) and offices for the Center for Veterinary Medicine (CVM). With the passing of the FDA Reauthorization Act of 2017, the FDA projects a 64% increase in employees to 18,000 over the next 15 years and wants to add approximately 1,600,000 square feet (150,000 square metres) of office and special use space to their existing facilities.
The Office of Criminal Investigations was established in 1991 to investigate criminal cases. To do so, OCI employs approximately 200 special agents nationwide who, unlike ORA Investigators, are armed, have badges, and do not focus on technical aspects of the regulated industries. Rather, OCI agents pursue and develop cases when individuals and companies commit criminal actions, such as fraudulent claims or knowingly and willfully shipping known adulterated goods in interstate commerce. In many cases, OCI pursues cases involving violations of Title 18 of the United States Code (e.g., conspiracy, false statements, wire fraud, mail fraud), in addition to prohibited acts as defined in Chapter III of the FD&C Act. OCI special agents often come from other criminal investigations backgrounds, and frequently work closely with the Federal Bureau of Investigation, assistant attorney general, and even Interpol.
Boise metropolitan area
Q4938481 EXACT TITLE 0.940
QID OVERLAP: Q4938481 in basque_culture (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "canyon", "commonly", "idaho", "nearly", "northwest", "percent", "population", "section", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
adaboisecanyoncommonlyidahonearlynorthwestpercentpopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Boise, Idaho
Q35775 EXACT TITLE 0.940
QID OVERLAP: Q35775 in basque_culture (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "capital", "employers", "idaho", "locally", "major", "population", "technology", "treasure", "valley". | EXACT TITLE in basque_culture: "Boise, Idaho".
adaannualboisecapitalemployersidaholocallymajorpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Idaho State University
Q1656608 EXACT TITLE 0.900
QID OVERLAP: Q1656608 in basque_culture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "activity", "among", "idaho", "percent", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in basque_culture: "Idaho State University". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
activityamongidahopercentprogramspublicresearchstudentsuniversitiesuniversity
ho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
ified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male. The student-teacher ratio at Idaho State is 13:1 and 58 percent of students take classes full-time. History On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in basque_culture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (21): "active", "business", "capital", "category", "control", "described", "development", "general", "management", "operational", "otherwise", "ownership", "partnerships", "private", "private-equity", "product", "products", "public", "rather", "role"....
activebusinesscapitalcategorycontroldescribeddevelopmentgeneralmanagementoperationalotherwiseownershippartnershipsprivateprivate-equityproductproductspublicratherrolespecialized
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in basque_culture (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "capital", "idaho", "jurisdiction", "local", "northwest", "population", "private".
adaboisecapitalidahojurisdictionlocalnorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in basque_culture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallypopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in basque_culture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "population".
boisecaldwellcanyonidahopopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
246 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP246 edges
🌿 BRANCH182 edges
0.500
Antibody ↗ Q79460 EXACT TITLE
allowingbecomecapacityclassificationdescribesdescribingdifferentdirectlydistinctessentialformfunctionfunctionsgeneralgenerallyidentifyindependentlyindividuallargeleast
SHARED TOKENS (37): "allowing", "become", "capacity", "classification", "describes", "describing", "different", "directly", "distinct", "essential", "form", "function", "functions", "general", "generally", "identify", "independently", "individual", "large", "least".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
addressagricultureanotherapplicationsappliesapprovalbackconsequentlycoreculturedefinitionsdevelopeddevelopmentdirectlyemphasizesengineeringenvironmentalfieldfunctionsgenerally
SHARED TOKENS (59): "address", "agriculture", "another", "applications", "applies", "approval", "back", "consequently", "core", "culture", "definitions", "developed", "development", "directly", "emphasizes", "engineering", "environmental", "field", "functions", "generally".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
amongapproximatelyboiseestablishedextensiongraduateidaholateroperatesproductionprofessionalpublicrepresentedresearchstatewidestudentsuidahouniversity
SHARED TOKENS (18): "among", "approximately", "boise", "established", "extension", "graduate", "idaho", "later", "operates", "production", "professional", "public", "represented", "research", "statewide", "students", "uidaho", "university". | EXACT TITLE in basque_culture: "University of Idaho". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
0.500
academicactivitiesactivitybecomefieldgenerallygovernmenthistoricalhistorylevelsmediaoutsidepeoplepracticepublicrelatedsciencesitesspecializedtraining
SHARED TOKENS (20): "academic", "activities", "activity", "become", "field", "generally", "government", "historical", "history", "levels", "media", "outside", "people", "practice", "public", "related", "science", "sites", "specialized", "training". | EXACT TITLE in basque_culture: "Public history".
0.500
Food code ↗ Q5465447 EXACT TITLE
codecodescommonlyconditionsestablishfoodfoundinternationalmaterialsnationalpreparationproductproductsregionalsectionstandards
SHARED TOKENS (16): "code", "codes", "commonly", "conditions", "establish", "food", "found", "international", "materials", "national", "preparation", "product", "products", "regional", "section", "standards". | EXACT TITLE in basque_culture: "Food code".
0.500
accessbuildingscentercommercialdevelopmentdistrictsevenhistoricallegalreceiveregionrelatedsectionseparatesettingsmallstatussupply
SHARED TOKENS (18): "access", "buildings", "center", "commercial", "development", "districts", "even", "historical", "legal", "receive", "region", "related", "section", "separate", "setting", "small", "status", "supply". | EXACT TITLE in basque_culture: "Historic district".
0.500
Diaspora ↗ EXACT TITLE
communitiescommunitycomplexdefinitionsdistinguisheseducationestablishedevengenerallygeographicidentifiedidentifylabormovementmultiplenetworksoriginoriginatingoutsidepeople
SHARED TOKENS (22): "communities", "community", "complex", "definitions", "distinguishes", "education", "established", "even", "generally", "geographic", "identified", "identify", "labor", "movement", "multiple", "networks", "origin", "originating", "outside", "people".... | EXACT TITLE in basque_culture: "Diaspora".
0.500
activityconditionsconsumeddependsdirectlydrinkingenvironmentalfoodformhealthmajorpeoplephysicalpreparationsafesuppliedwork
SHARED TOKENS (17): "activity", "conditions", "consumed", "depends", "directly", "drinking", "environmental", "food", "form", "health", "major", "people", "physical", "preparation", "safe", "supplied", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
accordingappliedbecomecomplexdifferentfieldfunctionidentifiedidentitymassmechanismpatternpresentedstructurethem
SHARED TOKENS (15): "according", "applied", "become", "complex", "different", "field", "function", "identified", "identity", "mass", "mechanism", "pattern", "presented", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
allowinganothercollectioncreatedevelopmentessentialfieldinsideinteractionlifephysicalremainssmallstandardstudiessubjectstechnicaltechniquestransmissionview
SHARED TOKENS (20): "allowing", "another", "collection", "create", "development", "essential", "field", "inside", "interaction", "life", "physical", "remains", "small", "standard", "studies", "subjects", "technical", "techniques", "transmission", "view". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialestablishmentsfoodgenerallyindividualmanagementmenumodelplacespracticesprivaterestaurantsrisksafetyservesservingsettingstaff
SHARED TOKENS (19): "business", "commercial", "establishments", "food", "generally", "individual", "management", "menu", "model", "places", "practices", "private", "restaurants", "risk", "safety", "serves", "serving", "setting", "staff". | EXACT TITLE in basque_culture: "Catering".
0.500
academicactivitiesadministrationamongbecomebroadercorporationsfieldgenerallygeographyhistoryinternationallawlegalmajormeetingsofficeorganizationspolicypublic
SHARED TOKENS (27): "academic", "activities", "administration", "among", "become", "broader", "corporations", "field", "generally", "geography", "history", "international", "law", "legal", "major", "meetings", "office", "organizations", "policy", "public".... | EXACT TITLE in basque_culture: "International relations".
0.500
Vaccine ↗ Q134808 EXACT TITLE
activeadministrationassociateddescribeddevelopeddevelopmentdifferenthealthlicensedorganizationpracticepreparationproductionreportssafetysciencesystemtitle
SHARED TOKENS (18): "active", "administration", "associated", "described", "developed", "development", "different", "health", "licensed", "organization", "practice", "preparation", "production", "reports", "safety", "science", "system", "title". | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
Archive ↗ Q166118 EXACT TITLE
accessactactivitiesarchivebuildingscommercialcontentdistinctdocumentsfacilityfoundfunctionfunctionsgenerallyhistoricalhistoryindividualinformationlegallibrary
SHARED TOKENS (31): "access", "act", "activities", "archive", "buildings", "commercial", "content", "distinct", "documents", "facility", "found", "function", "functions", "generally", "historical", "history", "individual", "information", "legal", "library".... | EXACT TITLE in basque_culture: "Archive". | EXACT TITLE in biotech_life_sciences: "Archive".
0.500
actadministrationauthoritycontrolfederalfoodformlawmedicalmembersnationalprincipalproductprovisionsrequirementssafetystudy
SHARED TOKENS (17): "act", "administration", "authority", "control", "federal", "food", "form", "law", "medical", "members", "national", "principal", "product", "provisions", "requirements", "safety", "study". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotcertificationconsumercreatesdescribingdevelopedenforcementfoodhealthinspectionlabelinglessmanagementmarketorganizationphysicalpracticespreparationrelatedsafe
SHARED TOKENS (24): "cannot", "certification", "consumer", "creates", "describing", "developed", "enforcement", "food", "health", "inspection", "labeling", "less", "management", "market", "organization", "physical", "practices", "preparation", "related", "safe".... | EXACT TITLE in biotech_life_sciences: "Food safety".
0.500
approvalcannotcostsdesigneddevelopmentevidenceexperienceformhouseinstitutionsinternationallargelifemanagementmarketsmedicalneedorganizationorganizationsresearch
SHARED TOKENS (27): "approval", "cannot", "costs", "designed", "development", "evidence", "experience", "form", "house", "institutions", "international", "large", "life", "management", "markets", "medical", "need", "organization", "organizations", "research".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
analysisarchitecturecommunitiescreatecreationculturedescribedeconomiceveneventsfieldgeographyhistoryidentitymaterialmediapeoplephysicalpracticerelationships
SHARED TOKENS (23): "analysis", "architecture", "communities", "create", "creation", "culture", "described", "economic", "even", "events", "field", "geography", "history", "identity", "material", "media", "people", "physical", "practice", "relationships".... | EXACT TITLE in basque_culture: "Material culture".
0.500
advancedagenciesbuildingcategoryclassificationcomplexconditionsdifferentdirectlyengineeringgeneralisolatedmarketmedicaloutsidepathwaysperformanceproductproductionproducts
SHARED TOKENS (30): "advanced", "agencies", "building", "category", "classification", "complex", "conditions", "different", "directly", "engineering", "general", "isolated", "market", "medical", "outside", "pathways", "performance", "product", "production", "products".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
amonganalysisappliedbettercollectionconditionsdatadescriptiondesigndisciplinesdrawengineeringenvironmentalexamplesfunctiongeneralhealthhistoricallyidentifyinginteraction
SHARED TOKENS (38): "among", "analysis", "applied", "better", "collection", "conditions", "data", "description", "design", "disciplines", "draw", "engineering", "environmental", "examples", "function", "general", "health", "historically", "identifying", "interaction".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
actadministrationappliesdrinkingenvironmentalfederalfoodlawprivatepublicregulatedsafestandardssystemsystems
SHARED TOKENS (15): "act", "administration", "applies", "drinking", "environmental", "federal", "food", "law", "private", "public", "regulated", "safe", "standards", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
cannotcollectiondatadifferenteventsformfoundgeneralhistoricalhistoryimportantinformationknowledgelargelifepeopleplannedpresentedprofessionalreceiving
SHARED TOKENS (24): "cannot", "collection", "data", "different", "events", "form", "found", "general", "historical", "history", "important", "information", "knowledge", "large", "life", "people", "planned", "presented", "professional", "receiving".... | EXACT TITLE in basque_culture: "Oral history".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeadvancedapplicationsassociatedbecomedisciplinesearlyessentialexistencehealthimportantinterpretedlaternodesphysicalratherrecognitionresponsesmallstudies
SHARED TOKENS (26): "active", "advanced", "applications", "associated", "become", "disciplines", "early", "essential", "existence", "health", "important", "interpreted", "later", "nodes", "physical", "rather", "recognition", "response", "small", "studies".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityadvancedbettercenteredcomplexcovereddescribeddiscoveryearlyfieldfunctiongoverninglevelsmedicalmodelorganizationphysicalresearchsciencestructure
SHARED TOKENS (26): "activity", "advanced", "better", "centered", "complex", "covered", "described", "discovery", "early", "field", "function", "governing", "levels", "medical", "model", "organization", "physical", "research", "science", "structure".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
commonlyconcentrationdesignedfacilitiesinsidemaintainsmaterialmaterialspermitsproductionresearchroomssmallerspacework
SHARED TOKENS (15): "commonly", "concentration", "designed", "facilities", "inside", "maintains", "material", "materials", "permits", "production", "research", "rooms", "smaller", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.500
Virology ↗ Q7215 EXACT TITLE
agricultureappliedbeginningclassificationcoveringculturedifferentdistinctfieldfunctionshealthidentificationinteractionmedicalmethodsofficialresearchsciencesignificantstructure
SHARED TOKENS (25): "agriculture", "applied", "beginning", "classification", "covering", "culture", "different", "distinct", "field", "functions", "health", "identification", "interaction", "medical", "methods", "official", "research", "science", "significant", "structure".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdevelopmenteconomicenvironmentenvironmentalgenerallyglobalinternationallesslocalmarketsorganizationorganizationsoutsidepeopleplaces
SHARED TOKENS (25): "activity", "beyond", "business", "commercial", "communities", "development", "economic", "environment", "environmental", "generally", "global", "international", "less", "local", "markets", "organization", "organizations", "outside", "people", "places".... | EXACT TITLE in basque_culture: "Tourism".
0.500
annualanotherbecomebusinesscapitalconductconsequentlycontroldevelopmentearlyemployeesentityformfundinghistoryinformationinitialinstitutionalmarketmarkets
SHARED TOKENS (37): "annual", "another", "become", "business", "capital", "conduct", "consequently", "control", "development", "early", "employees", "entity", "form", "funding", "history", "information", "initial", "institutional", "market", "markets".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
analysisappliesapprovalboardcodescommonlyconductformhealthimprovedindependentinstitutioninstitutionalinternationalinvolvinglegallymaterialsmedicalmethodsnational
SHARED TOKENS (37): "analysis", "applies", "approval", "board", "codes", "commonly", "conduct", "form", "health", "improved", "independent", "institution", "institutional", "international", "involving", "legally", "materials", "medical", "methods", "national".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
approximatelycommonlycomplexconcentrationcurrentdepartmenteasternengineeringenvironmentalfacilitiesfacilityhistoricallyhistoryidahoknowledgenationalorganizationspeopleresearchsite
SHARED TOKENS (21): "approximately", "commonly", "complex", "concentration", "current", "department", "eastern", "engineering", "environmental", "facilities", "facility", "historically", "history", "idaho", "knowledge", "national", "organizations", "people", "research", "site".... | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
Metadata ↗ Q180160 EXACT TITLE
accessactivitiesallowinganalysisarchiveassetclassifycreatecreationculturedatadescribesdescribingdifferentdisciplinesdocumentexamplesexperiencefoundfunctions
SHARED TOKENS (45): "access", "activities", "allowing", "analysis", "archive", "asset", "classify", "create", "creation", "culture", "data", "describes", "describing", "different", "disciplines", "document", "examples", "experience", "found", "functions".... | EXACT TITLE in basque_culture: "Metadata".
0.500
businessescategorycreatecreationdevelopedeconomicgivesindividualinformationlandlawlegalmodernownershippeopleproducerspropertypurposerightssystems
SHARED TOKENS (21): "businesses", "category", "create", "creation", "developed", "economic", "gives", "individual", "information", "land", "law", "legal", "modern", "ownership", "people", "producers", "property", "purpose", "rights", "systems".... | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
Microbiology ↗ Q7193 EXACT TITLE
complexculturecurrentdesigndevelopedexistenceidentificationlesslifematerialmeansmedicalsearchsmallstudythemtoolswork
SHARED TOKENS (18): "complex", "culture", "current", "design", "developed", "existence", "identification", "less", "life", "material", "means", "medical", "search", "small", "study", "them", "tools", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecommonlycommunitydirectestablishmenthealthinformationinstitutionallinksmodernofficepracticeproductsprofessionalrelatedsafesafetysciencescopesell
SHARED TOKENS (24): "become", "commonly", "community", "direct", "establishment", "health", "information", "institutional", "links", "modern", "office", "practice", "products", "professional", "related", "safe", "safety", "science", "scope", "sell".... | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
actadministrationagenciesclassificationcontrolenforcementestablishingfederalfoodinitialinternationalisolatedlawlistingmedicalnationalpolicyregulatedscheduledsingle
SHARED TOKENS (21): "act", "administration", "agencies", "classification", "control", "enforcement", "establishing", "federal", "food", "initial", "international", "isolated", "law", "listing", "medical", "national", "policy", "regulated", "scheduled", "single".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
activeanalysisapplicationsbeginningcontroldesigndevelopmentemergedexamplesfieldformhundredsmeansmediamovementotherwisepracticalscienceseparatesingle
SHARED TOKENS (25): "active", "analysis", "applications", "beginning", "control", "design", "development", "emerged", "examples", "field", "form", "hundreds", "means", "media", "movement", "otherwise", "practical", "science", "separate", "single".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
addressagriculturalappliedcontrolcreatedesignengineeringexamplesgenerallyknowledgemassmaterialsmedicalproductsresearchresearcherssciencespacestandardssystems
SHARED TOKENS (24): "address", "agricultural", "applied", "control", "create", "design", "engineering", "examples", "generally", "knowledge", "mass", "materials", "medical", "products", "research", "researchers", "science", "space", "standards", "systems".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Patent ↗ Q253623 EXACT TITLE
accordingamonggivesinternationallawlegalmodelsnationalorganizationprivatepropertypublicratherrequirementsrightsscopesubjecttechnologytype
SHARED TOKENS (19): "according", "among", "gives", "international", "law", "legal", "models", "national", "organization", "private", "property", "public", "rather", "requirements", "rights", "scope", "subject", "technology", "type". | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
agriculturalanalysisbetterbuildingcomplexdatadevelopmentdevelopsengineeringfieldidentificationimportantinformationlargemethodsmodelsnetworkspathwaysprocessingprogramming
SHARED TOKENS (28): "agricultural", "analysis", "better", "building", "complex", "data", "development", "develops", "engineering", "field", "identification", "important", "information", "large", "methods", "models", "networks", "pathways", "processing", "programming".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anotherdevelopmentdifferentengineeringfieldfunctionhistorylargematerialmaterialsmedicalproductspurposesciencestudysystemsystems
SHARED TOKENS (17): "another", "development", "different", "engineering", "field", "function", "history", "large", "material", "materials", "medical", "products", "purpose", "science", "study", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
communityconnectedconsequentlyculturedevelopmenteconomicenvironmentalformhistoricalhistoricallyhistorylocalpracticesregionresourcessignificantsitesspecificallythemtype
SHARED TOKENS (20): "community", "connected", "consequently", "culture", "development", "economic", "environmental", "form", "historical", "historically", "history", "local", "practices", "region", "resources", "significant", "sites", "specifically", "them", "type". | EXACT TITLE in basque_culture: "Heritage tourism".
0.500
adjacentcentralcorecurrentdevelopeddifferentearlyeducationevenformformalgovernmentlatermassmediaofficialoriginpeoplepublicregion
SHARED TOKENS (29): "adjacent", "central", "core", "current", "developed", "different", "early", "education", "even", "form", "formal", "government", "later", "mass", "media", "official", "origin", "people", "public", "region".... | EXACT TITLE in basque_culture: "Basque language".
0.500
actadministrationbureaucommunitydepartmentenforcementestablishedfederalgovernmentinvolvingjurisdictionlawnationaloperationsratherreports
SHARED TOKENS (16): "act", "administration", "bureau", "community", "department", "enforcement", "established", "federal", "government", "involving", "jurisdiction", "law", "national", "operations", "rather", "reports". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
activityapprovalauthoritybecomecentercentralcollectionconductcostsdatadependingdesigndesigneddevelopmentfunctionshealthmedicalmultipleorganizationpartner
SHARED TOKENS (35): "activity", "approval", "authority", "become", "center", "central", "collection", "conduct", "costs", "data", "depending", "design", "designed", "development", "functions", "health", "medical", "multiple", "organization", "partner".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionalboardbusinesscenterclassifyculturedepartmentdepartmentsdirectearlyeconomyenvironmentestablishmentestablishmentsexecutivefacilitiesfacilityfoodform
SHARED TOKENS (48): "access", "additional", "board", "business", "center", "classify", "culture", "department", "departments", "direct", "early", "economy", "environment", "establishment", "establishments", "executive", "facilities", "facility", "food", "form".... | EXACT TITLE in basque_culture: "Hotel".
0.500
Ranch ↗ Q509028 EXACT TITLE
additionalappliedbureaucontrolexclusivelyfederalgenerallyirrigatedlandlargelesslivestockmanagementnearlyoperateoperationspeoplepracticeprivateproperty
SHARED TOKENS (22): "additional", "applied", "bureau", "control", "exclusively", "federal", "generally", "irrigated", "land", "large", "less", "livestock", "management", "nearly", "operate", "operations", "people", "practice", "private", "property".... | EXACT TITLE in basque_culture: "Ranch".
0.500
actagenciesamongbuildingsfederalfederallylawnationalpdfplacesprojectsprovisionsrequiresreviewsectionsitestext
SHARED TOKENS (17): "act", "agencies", "among", "buildings", "federal", "federally", "law", "national", "pdf", "places", "projects", "provisions", "requires", "review", "section", "sites", "text". | EXACT TITLE in basque_culture: "National Historic Preservation Act".
0.500
agriculturalappliedcentralconductdesigndevelopmentdirectlyearlyevaluationfieldfoodlifematerialsmethodsmodernorganizedperformpracticesprocessingproduction
SHARED TOKENS (27): "agricultural", "applied", "central", "conduct", "design", "development", "directly", "early", "evaluation", "field", "food", "life", "materials", "methods", "modern", "organized", "perform", "practices", "processing", "production".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
amongcreatescultureeconomicimportantinfluenceinformationinstitutionsnationalpeoplepublicpurposerolesupportturntype
SHARED TOKENS (16): "among", "creates", "culture", "economic", "important", "influence", "information", "institutions", "national", "people", "public", "purpose", "role", "support", "turn", "type". | EXACT TITLE in basque_culture: "Cultural diplomacy".
0.500
annualcapitalcentercommunitiesculturedifferentgenerallyinternationalnationaloccupationspeopleperformancepractitionerspresentedproducesprogramprogramspublicregionworkers
SHARED TOKENS (20): "annual", "capital", "center", "communities", "culture", "different", "generally", "international", "national", "occupations", "people", "performance", "practitioners", "presented", "produces", "program", "programs", "public", "region", "workers". | EXACT TITLE in basque_culture: "Smithsonian Folklife Festival".
0.500
Genealogy ↗ Q47307 EXACT TITLE
additionalanalysisbroadercommunityfamilyfieldhistoricalhistoryinformationlegalmemberspresentedpurposesrecordrecordsresearchstudywork
SHARED TOKENS (18): "additional", "analysis", "broader", "community", "family", "field", "historical", "history", "information", "legal", "members", "presented", "purposes", "record", "records", "research", "study", "work". | EXACT TITLE in basque_culture: "Genealogy".
0.500
analysisassociatedcostsdependingdifferentestablishingformlatermaterialproductionpurposeseparatesitessmallersystemtechniquesthem
SHARED TOKENS (17): "analysis", "associated", "costs", "depending", "different", "establishing", "form", "later", "material", "production", "purpose", "separate", "sites", "smaller", "system", "techniques", "them". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
Bilbao ↗ Q8692 EXACT TITLE
activityadjacentannualbeginningcapitalcommercialcommunitycoredevelopmenteconomicfamilyhistoryinfrastructureinternationalpopulationprojectsrecognitionregionsignificantsmall
SHARED TOKENS (23): "activity", "adjacent", "annual", "beginning", "capital", "commercial", "community", "core", "development", "economic", "family", "history", "infrastructure", "international", "population", "projects", "recognition", "region", "significant", "small".... | EXACT TITLE in basque_culture: "Bilbao".
0.500
academicdepartmentfundinggovernedhealthinstitutionalinstitutionsinvolvingnearlypublicresearchresearchersreviewrightsrulesignificantstandardsubjectstitlewelfare
SHARED TOKENS (20): "academic", "department", "funding", "governed", "health", "institutional", "institutions", "involving", "nearly", "public", "research", "researchers", "review", "rights", "rule", "significant", "standard", "subjects", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongapplicationscurrentdesigndevelopmentemergedengineeringfieldhealthmanagementmedicalpurposesrelevantresearchrolescopestandardswork
SHARED TOKENS (18): "among", "applications", "current", "design", "development", "emerged", "engineering", "field", "health", "management", "medical", "purposes", "relevant", "research", "role", "scope", "standards", "work". | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
Livestock ↗ Q103459 EXACT TITLE
agriculturalagriculturecommercialcommunitieseconomicenvironmentgeneralhealthlaborlivestockmajormaterialmodernpracticesproductspublicrolesettingsolelywelfare
SHARED TOKENS (20): "agricultural", "agriculture", "commercial", "communities", "economic", "environment", "general", "health", "labor", "livestock", "major", "material", "modern", "practices", "products", "public", "role", "setting", "solely", "welfare". | EXACT TITLE in basque_culture: "Livestock". | EXACT TITLE in biotech_life_sciences: "Livestock".
0.500
actassociatedbackcomplexdesigndiscoveryengineeringestablishestablishedexamplesfederalfieldfoodgeneralgloballaterlifemajormarketmedical
SHARED TOKENS (31): "act", "associated", "back", "complex", "design", "discovery", "engineering", "establish", "established", "examples", "federal", "field", "food", "general", "global", "later", "life", "major", "market", "medical".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
Pathology ↗ Q7208 EXACT TITLE
addressesanalysisconditionsdevelopmentdifferentdistinctfieldgeneralmajormedicalmodernphysicalpracticepracticesresearchsignificantstudysystems
SHARED TOKENS (18): "addresses", "analysis", "conditions", "development", "different", "distinct", "field", "general", "major", "medical", "modern", "physical", "practice", "practices", "research", "significant", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
Museum ↗ Q33506 EXACT TITLE
associateddedicateddrawestablishmenthistoryinstitutionlargelaterlocaloutsideprivatepublicresearcherssciencesignificantspecialists
SHARED TOKENS (16): "associated", "dedicated", "draw", "establishment", "history", "institution", "large", "later", "local", "outside", "private", "public", "researchers", "science", "significant", "specialists". | EXACT TITLE in basque_culture: "Museum".
0.500
advancedanalysisapplieddevelopmentdifferentengineeringevaluationfieldformgenerallyhealthidentifyimportantknowledgelatermedicalperformpracticeprovidersrequire
SHARED TOKENS (27): "advanced", "analysis", "applied", "development", "different", "engineering", "evaluation", "field", "form", "generally", "health", "identify", "important", "knowledge", "later", "medical", "perform", "practice", "providers", "require".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
academicactivitiesanalysisapplicationscommercialconductdatadegreedevelopmentdifferentfieldgenerallygovernmentgraduateimprovedotherwiseprogramprogramsremainresearch
SHARED TOKENS (25): "academic", "activities", "analysis", "applications", "commercial", "conduct", "data", "degree", "development", "different", "field", "generally", "government", "graduate", "improved", "otherwise", "program", "programs", "remain", "research".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureappliescentralcollectionconditionsconsolidationcontroldevelopeddirectlydistributedenvironmentalfieldformirrigationlandlesslivestockmanagementmethods
SHARED TOKENS (33): "agricultural", "agriculture", "applies", "central", "collection", "conditions", "consolidation", "control", "developed", "directly", "distributed", "environmental", "field", "form", "irrigation", "land", "less", "livestock", "management", "methods".... | EXACT TITLE in basque_culture: "Irrigation". | EXACT TITLE in biotech_life_sciences: "Irrigation".
0.500
acquisitionactivitycapitalchildrenconcentrationcostscreatedependsdescribesdevelopeddevelopmenteconomiceconomyemploymentevenfoundgeographicgovernmentidentityinformation
SHARED TOKENS (39): "acquisition", "activity", "capital", "children", "concentration", "costs", "create", "depends", "describes", "developed", "development", "economic", "economy", "employment", "even", "found", "geographic", "government", "identity", "information".... | EXACT TITLE in basque_culture: "Ethnic enclave".
0.500
Cemetery ↗ Q39614 EXACT TITLE
accordinganotherappliedcommonlyimplieslandmodernotherwisepeoplepracticesprincipalremainsspacespecificallywestern
SHARED TOKENS (15): "according", "another", "applied", "commonly", "implies", "land", "modern", "otherwise", "people", "practices", "principal", "remains", "space", "specifically", "western". | EXACT TITLE in basque_culture: "Cemetery".
0.500
associationsbusinesscommunitydependingentityinstitutionlocalmissionoperatesoperationsorganizationorganizationsprivateprogrampublicpurposeratherreceiverevenuestatus
SHARED TOKENS (21): "associations", "business", "community", "depending", "entity", "institution", "local", "mission", "operates", "operations", "organization", "organizations", "private", "program", "public", "purpose", "rather", "receive", "revenue", "status".... | EXACT TITLE in basque_culture: "Nonprofit organization".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureappliedassociatedbecomecontroldependsdevelopeddisciplinesdistinctengineeringenvironmentfunctionfunctionshealthlifemethodsperformrelatedresearchsmall
SHARED TOKENS (26): "agriculture", "applied", "associated", "become", "control", "depends", "developed", "disciplines", "distinct", "engineering", "environment", "function", "functions", "health", "life", "methods", "perform", "related", "research", "small".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
academicadaadultboardboisecanyoncollegecommunitydevelopmenteasterneducationgovernedidaholargepopulationprogramspublicreportedresidentsstudents
SHARED TOKENS (26): "academic", "ada", "adult", "board", "boise", "canyon", "college", "community", "development", "eastern", "education", "governed", "idaho", "large", "population", "programs", "public", "reported", "residents", "students".... | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
0.500
advancedbecomebuildingsdesignearlyexamplesexperiencegeneralgenerallygeographygovernmentlegalownershipparticipationplacesprivatepropertypublicrequirerights
SHARED TOKENS (25): "advanced", "become", "buildings", "design", "early", "examples", "experience", "general", "generally", "geography", "government", "legal", "ownership", "participation", "places", "private", "property", "public", "require", "rights".... | EXACT TITLE in basque_culture: "Public space".
0.500
appliedassociatedcapacitycapitalcostsdirectlydocumentearlyestablishingformimportantinformationinitialinstitutionallegalmarketmethodsprivatepublicpublicly
SHARED TOKENS (26): "applied", "associated", "capacity", "capital", "costs", "directly", "document", "early", "establishing", "form", "important", "information", "initial", "institutional", "legal", "market", "methods", "private", "public", "publicly".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
anothercommonlydocumentationhistoricalinitiallargemethodsmodelsofficialprofessionalremainrequirestechnicaltechniquestexttools
SHARED TOKENS (16): "another", "commonly", "documentation", "historical", "initial", "large", "methods", "models", "official", "professional", "remain", "requires", "technical", "techniques", "text", "tools". | EXACT TITLE in basque_culture: "Machine translation".
0.500
academiccentercentralcertificationeducationemployersfacultyinstitutionsknowledgelifemembersmissionprivateproductionpublicratherresearchsitesstudentstransfer
SHARED TOKENS (22): "academic", "center", "central", "certification", "education", "employers", "faculty", "institutions", "knowledge", "life", "members", "mission", "private", "production", "public", "rather", "research", "sites", "students", "transfer".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.500
anotherdescribesemploymentinitialmakesmeansmovemovementopportunitiespeoplepolicyprogramrelationshipstransportationturn
SHARED TOKENS (15): "another", "describes", "employment", "initial", "makes", "means", "move", "movement", "opportunities", "people", "policy", "program", "relationships", "transportation", "turn". | EXACT TITLE in basque_culture: "Chain migration".
0.480
backdevelopmentengineeringexamplesfieldinterpretedmajormedicalmovementphysicalrolesciencestructurework
SHARED TOKENS (14): "back", "development", "engineering", "examples", "field", "interpreted", "major", "medical", "movement", "physical", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.480
categoriesclassifycodesentityidentificationinformationmedicalorgorganizationorganizationsrecognitionresearchsystemstext
SHARED TOKENS (14): "categories", "classify", "codes", "entity", "identification", "information", "medical", "org", "organization", "organizations", "recognition", "research", "systems", "text". | EXACT TITLE in basque_culture: "Named-entity recognition".
0.460
contentdependsdifferentdistincteducationeducationalhistorymodelmodelsresearchsciencestudentssubject
SHARED TOKENS (13): "content", "depends", "different", "distinct", "education", "educational", "history", "model", "models", "research", "science", "students", "subject". | EXACT TITLE in basque_culture: "Bilingual education".
0.460
Toxicology ↗ Q7218 EXACT TITLE
academicenvironmentfieldinfluencemovementoverlappingpracticepracticesrelationshipresearchstudysubjectturn
SHARED TOKENS (13): "academic", "environment", "field", "influence", "movement", "overlapping", "practice", "practices", "relationship", "research", "study", "subject", "turn". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.460
accordingappliescontroldesigndisciplinesengineeringfieldfoundmaterialpurposessciencesystemsthem
SHARED TOKENS (13): "according", "applies", "control", "design", "disciplines", "engineering", "field", "found", "material", "purposes", "science", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.460
Pamplona ↗ Q10282 EXACT TITLE
backcapitalcommunityearlyevenformhistoricallylaternearpopulationrulesanserving
SHARED TOKENS (13): "back", "capital", "community", "early", "even", "form", "historically", "later", "near", "population", "rule", "san", "serving". | EXACT TITLE in basque_culture: "Pamplona".
0.460
Trikiti ↗ Q1999898 EXACT TITLE
consolidatedevidencefoundinternationallocalmodernpatternperformremainseparatestandardthereforeworkers
SHARED TOKENS (13): "consolidated", "evidence", "found", "international", "local", "modern", "pattern", "perform", "remain", "separate", "standard", "therefore", "workers". | EXACT TITLE in basque_culture: "Trikiti".
0.450
govgovernmenthealthlibrarynational
SHARED TOKENS (5): "gov", "government", "health", "library", "national". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
activitiescapitalcommercecommunitycultureeconomiceventsinternationalliespopulationsansmall
SHARED TOKENS (12): "activities", "capital", "commerce", "community", "culture", "economic", "events", "international", "lies", "population", "san", "small". | EXACT TITLE in basque_culture: "San Sebastián".
0.440
Tavern ↗ Q154250 EXACT TITLE
businessderivesdifferentdrinkingfoodhistoricallypeoplepublicreceivestandardtypewhose
SHARED TOKENS (12): "business", "derives", "different", "drinking", "food", "historically", "people", "public", "receive", "standard", "type", "whose". | EXACT TITLE in basque_culture: "Tavern".
0.440
combinesdescribeddifferentfunctionsindividualsciencescopestatisticsstudiesstudysystemtechniques
SHARED TOKENS (12): "combines", "described", "different", "functions", "individual", "science", "scope", "statistics", "studies", "study", "system", "techniques". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.440
Cell biology ↗ Q7141 EXACT TITLE
cultureessentialfunctiongiveslifemedicalresearchstructurestudiesstudytechniqueswork
SHARED TOKENS (12): "culture", "essential", "function", "gives", "life", "medical", "research", "structure", "studies", "study", "techniques", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.420
approximatelyboisebuildingcapacitycentralcurrentidahoprofessionalrightstitlewestern
SHARED TOKENS (11): "approximately", "boise", "building", "capacity", "central", "current", "idaho", "professional", "rights", "title", "western". | EXACT TITLE in basque_culture: "Idaho Central Arena".
0.400
Hay ↗ Q336989 EXACT TITLE
accesscannotcommonlyfieldhealthlargelivestockprocessingproductionsmaller
SHARED TOKENS (10): "access", "cannot", "commonly", "field", "health", "large", "livestock", "processing", "production", "smaller". | EXACT TITLE in basque_culture: "Hay".
0.400
communitiescommunityculturefundinggovernmentlandpeopleregionschoolwestern
SHARED TOKENS (10): "communities", "community", "culture", "funding", "government", "land", "people", "region", "school", "western". | EXACT TITLE in basque_culture: "Basque Country (greater region)".
0.400
Biosensor ↗ Q669391 EXACT TITLE
anotherassociatedcombinesconnectsdifferentengineeringinteractionmaterialstudyuser
SHARED TOKENS (10): "another", "associated", "combines", "connects", "different", "engineering", "interaction", "material", "study", "user". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.400
Preschool ↗ Q1076052 EXACT TITLE
beginchildrenearlyeducationeducationalestablishmentpublicpubliclyschoolspace
SHARED TOKENS (10): "begin", "children", "early", "education", "educational", "establishment", "public", "publicly", "school", "space". | EXACT TITLE in basque_culture: "Preschool".
0.400
agriculturalculturedevelopeddifferentengineeringinvolvingproductssciencetechniquestools
SHARED TOKENS (10): "agricultural", "culture", "developed", "different", "engineering", "involving", "products", "science", "techniques", "tools". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.400
Restaurant ↗ Q11707 EXACT TITLE
businessestablishmentestablishmentsfamilyfoodgenerallymodelsrestaurantsservessingle
SHARED TOKENS (10): "business", "establishment", "establishments", "family", "food", "generally", "models", "restaurants", "serves", "single". | EXACT TITLE in basque_culture: "Restaurant". | EXACT TITLE in biotech_life_sciences: "Restaurant".
0.380
businessformgovernmentlifematerialpracticesprivatepublicrather
SHARED TOKENS (9): "business", "form", "government", "life", "material", "practices", "private", "public", "rather". | EXACT TITLE in basque_culture: "Philanthropy".
0.380
agriculturalanotherenvironmentfacilitymunicipalperformspurposetreatedtype
SHARED TOKENS (9): "agricultural", "another", "environment", "facility", "municipal", "performs", "purpose", "treated", "type". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.380
actchaptercodefederalhealthlawpublictitlewelfare
SHARED TOKENS (9): "act", "chapter", "code", "federal", "health", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.380
differentfacilityinformationmaterialmaterialsmedicalpeopleresearchstudies
SHARED TOKENS (9): "different", "facility", "information", "material", "materials", "medical", "people", "research", "studies". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.380
buildingcentercommunitycomplexculturefacilitiesorganizationorganizationsprivate
SHARED TOKENS (9): "building", "center", "community", "complex", "culture", "facilities", "organization", "organizations", "private". | EXACT TITLE in basque_culture: "Cultural center".
0.360
analysisapplieddatafieldrelationshipssciencesystemstechniques
SHARED TOKENS (8): "analysis", "applied", "data", "field", "relationships", "science", "systems", "techniques". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.360
Hazardous waste ↗ EXACT TITLE
environmenthealthinternationallocalmaterialsnationalproducesregulated
SHARED TOKENS (8): "environment", "health", "international", "local", "materials", "national", "produces", "regulated". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.360
buildingsconservationdevelopmentenvironmenthistoricalmaintainsproductsspecifically
SHARED TOKENS (8): "buildings", "conservation", "development", "environment", "historical", "maintains", "products", "specifically". | EXACT TITLE in basque_culture: "Historic preservation".
0.360
departmentdevelopmenteconomicidahoinsurancelabortechnologyworkforce
SHARED TOKENS (8): "department", "development", "economic", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.360
Choir ↗ Q131186 EXACT TITLE
applieddifferentimpliesperformperformssmallspecificallyturn
SHARED TOKENS (8): "applied", "different", "implies", "perform", "performs", "small", "specifically", "turn". | EXACT TITLE in basque_culture: "Choir".
0.360
architectureessentialexperiencehistoricalproductsregionsystemstype
SHARED TOKENS (8): "architecture", "essential", "experience", "historical", "products", "region", "systems", "type". | EXACT TITLE in basque_culture: "Cultural tourism".
0.360
agenciesapproximatelycomcontentestablishmentsonlineoperatespercent
SHARED TOKENS (8): "agencies", "approximately", "com", "content", "establishments", "online", "operates", "percent". | EXACT TITLE in basque_culture: "Tripadvisor".
0.360
Paella ↗ Q212121 EXACT TITLE
adjacentbackcommunityformidentifyinglivestocklocalmodern
SHARED TOKENS (8): "adjacent", "back", "community", "form", "identifying", "livestock", "local", "modern". | EXACT TITLE in basque_culture: "Paella".
0.360
Histology ↗ Q7168 EXACT TITLE
fieldhistoricallyidentificationmodernplacesstudiesstudyvisible
SHARED TOKENS (8): "field", "historically", "identification", "modern", "places", "studies", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.360
Accordion ↗ Q79838 EXACT TITLE
departmentsessentialfamilyinsidelessrelatedsectiontype
SHARED TOKENS (8): "departments", "essential", "family", "inside", "less", "related", "section", "type". | EXACT TITLE in basque_culture: "Accordion".
0.340
administrationcannotcommunitydemandfieldformpreparation
SHARED TOKENS (7): "administration", "cannot", "community", "demand", "field", "form", "preparation". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.340
boisedepartmentenvironmentalfederalgovernmentidahoregional
SHARED TOKENS (7): "boise", "department", "environmental", "federal", "government", "idaho", "regional". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.340
economichistoricaloriginoutsidepeoplepopulationsubstantial
SHARED TOKENS (7): "economic", "historical", "origin", "outside", "people", "population", "substantial". | EXACT TITLE in basque_culture: "Basque diaspora".
0.340
actconservationfederalgoverninglawrecoveryresource
SHARED TOKENS (7): "act", "conservation", "federal", "governing", "law", "recovery", "resource". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.340
evenfunctionmethodsoperatesstructurestudysystems
SHARED TOKENS (7): "even", "function", "methods", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.330
federalgovernmenthealthlibrarymedicalnationalrelatedreportstechnical
SHARED TOKENS (9): "federal", "government", "health", "library", "medical", "national", "related", "reports", "technical". | URL->B (1): http://clinicaltrials.gov/.
0.320
associationassociationsorganizationrelatedresearchserves
SHARED TOKENS (6): "association", "associations", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.320
childrencommonlyformidentificationidentifyingtext
SHARED TOKENS (6): "children", "commonly", "form", "identification", "identifying", "text". | EXACT TITLE in basque_culture: "Part-of-speech tagging".
0.320
Phlebotomy ↗ Q3595842 EXACT TITLE
adultinvolvingmedicalperformspurposevolume
SHARED TOKENS (6): "adult", "involving", "medical", "performs", "purpose", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.320
Basques ↗ Q126756 EXACT TITLE
amongculturedirectregionsharedwestern
SHARED TOKENS (6): "among", "culture", "direct", "region", "shared", "western". | EXACT TITLE in basque_culture: "Basques".
0.320
Chorizo ↗ Q23374 EXACT TITLE
differentnationaloriginatingproductsregionaltype
SHARED TOKENS (6): "different", "national", "originating", "products", "regional", "type". | EXACT TITLE in basque_culture: "Chorizo".
0.320
conditionseconomicenvironmentalidentificationmanagementstudy
SHARED TOKENS (6): "conditions", "economic", "environmental", "identification", "management", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.300
affectingalonebecomecommunityconnectingcreateculturecurrentdiversitydocumentationeconomicessentialestimatesevenfieldfundinggeneralhistoryidentityland
SHARED TOKENS (37): "affecting", "alone", "become", "community", "connecting", "create", "culture", "current", "diversity", "documentation", "economic", "essential", "estimates", "even", "field", "funding", "general", "history", "identity", "land"....
0.300
analysisappliedarchitecturebeyondcommercialdatadependentdevelopmentdifferentenvironmentalevenfacilitiesfunctionsgenerallyhistoricallyinformationinfrastructureinterfacesmanagementmarkets
SHARED TOKENS (37): "analysis", "applied", "architecture", "beyond", "commercial", "data", "dependent", "development", "different", "environmental", "even", "facilities", "functions", "generally", "historically", "information", "infrastructure", "interfaces", "management", "markets"....
0.300
appliesbecomebuildingscommunitiesconnectionconservationculturedocumentseconomicglobalhistoricalinternationalknowledgelegallocalmajornationalphysicalproductproperty
SHARED TOKENS (24): "applies", "become", "buildings", "communities", "connection", "conservation", "culture", "documents", "economic", "global", "historical", "international", "knowledge", "legal", "local", "major", "national", "physical", "product", "property"....
0.300
accordingagriculturalagriculturebackbeginningcontroldevelopeddirectearlyenvironmentalgeneralgenerallyhealthhistoryimportantimprovedlargelivestockmethodspipeline
SHARED TOKENS (29): "according", "agricultural", "agriculture", "back", "beginning", "control", "developed", "direct", "early", "environmental", "general", "generally", "health", "history", "important", "improved", "large", "livestock", "methods", "pipeline"....
0.300
appliedbusinesscapitalcorporatecorporationsdevelopmenteducationalemploymentgovernmentinstitutionslocalnetworksplacesplannersprivatepublicrelatedresearchrevenuesupporting
SHARED TOKENS (23): "applied", "business", "capital", "corporate", "corporations", "development", "educational", "employment", "government", "institutions", "local", "networks", "places", "planners", "private", "public", "related", "research", "revenue", "supporting"....
0.300
activitiesanotherappliedappliesauthorityauthorizedboardcapacityconditionsconductdefinitionsevidenceformgenerallyindividualinformationinstitutionalinternationallawlegal
SHARED TOKENS (37): "activities", "another", "applied", "applies", "authority", "authorized", "board", "capacity", "conditions", "conduct", "definitions", "evidence", "form", "generally", "individual", "information", "institutional", "international", "law", "legal"....
0.300
actadministrationapprovalboardcommercialcontroldatadesignestablishmentevaluationfoodinformationinstitutionalknowledgelabelinglegallyneedpermitspurposerecords
SHARED TOKENS (36): "act", "administration", "approval", "board", "commercial", "control", "data", "design", "establishment", "evaluation", "food", "information", "institutional", "knowledge", "labeling", "legally", "need", "permits", "purpose", "records"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysisdistinctfieldfoodfunctionsgenerallyidentificationimportantlargemassrequirementsscopesinglespecificallystructurestudysystem
SHARED TOKENS (18): "activity", "analysis", "distinct", "field", "food", "functions", "generally", "identification", "important", "large", "mass", "requirements", "scope", "single", "specifically", "structure", "study", "system".
0.300
anotherassociatedbecomechildrencommonlycommunitiesdiversitydocumentingeasterneconomiceducationgeneralhistoryinvolvingmasspeoplepopulationprojectsregionalrisk
SHARED TOKENS (21): "another", "associated", "become", "children", "commonly", "communities", "diversity", "documenting", "eastern", "economic", "education", "general", "history", "involving", "mass", "people", "population", "projects", "regional", "risk"....
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsideapplicationsdesigndiscoveryfieldfunctionfunctionshealthinteractionmedicaloriginpracticeresearchrolesciencespecificallystudiessystems
SHARED TOKENS (18): "alongside", "applications", "design", "discovery", "field", "function", "functions", "health", "interaction", "medical", "origin", "practice", "research", "role", "science", "specifically", "studies", "systems".
0.300
actbecomebuildingbuildingsdepartmentdistrictsestablishedfederalgeneralgovernmenthistoricalhistoryidentifyindividualmultiplenationalofficialplacespropertypublic
SHARED TOKENS (26): "act", "become", "building", "buildings", "department", "districts", "established", "federal", "general", "government", "historical", "history", "identify", "individual", "multiple", "national", "official", "places", "property", "public"....
0.300
bureaubusinessbusinessescommercecommunitiescommunitycurrentdatadepartmentdepartmentseconomiceconomyfederalgovernmenthouseinformationinfrastructurelocalmissionpeople
SHARED TOKENS (27): "bureau", "business", "businesses", "commerce", "communities", "community", "current", "data", "department", "departments", "economic", "economy", "federal", "government", "house", "information", "infrastructure", "local", "mission", "people"....
0.300
accordingactapproximatelycategoriescentralchildrendatadiversityearlyeasterneconomiceconomyemployersenvironmentalestimatesevidencefamilygenerallyglobalgovernment
SHARED TOKENS (44): "according", "act", "approximately", "categories", "central", "children", "data", "diversity", "early", "eastern", "economic", "economy", "employers", "environmental", "estimates", "evidence", "family", "generally", "global", "government"....
0.300
additionalassociationassociationsbusinessdepartmentsemploymententerenvironmentalexamplesformfunctiongovernmentincorporatedlargeleastlocalmembersmembershipneedoccupational
SHARED TOKENS (33): "additional", "association", "associations", "business", "departments", "employment", "enter", "environmental", "examples", "form", "function", "government", "incorporated", "large", "least", "local", "members", "membership", "need", "occupational"....
0.300
accessactivityadministrationarchivebuildingcontentdatadescribingdocumentshistoricallatermaterialsmethodsphysicalprocessingrecordrecordssciencestudiesstudy
SHARED TOKENS (22): "access", "activity", "administration", "archive", "building", "content", "data", "describing", "documents", "historical", "later", "materials", "methods", "physical", "processing", "record", "records", "science", "studies", "study"....
0.300
classificationexplainsfieldhistoryidentifyinformationmajormedicalphysicalprofessionalrecognitionseekingstatisticsstudyview
SHARED TOKENS (15): "classification", "explains", "field", "history", "identify", "information", "major", "medical", "physical", "professional", "recognition", "seeking", "statistics", "study", "view".
0.300
Farmworker ↗ Q5060555 KW CROSS HIGH
addressagriculturalagricultureassociatedconditionsdegreedependingeconomicenvironmentalhealthlaborlaworganizedperformsproductionrelatedrightstechnologyvalleywork
SHARED TOKENS (20): "address", "agricultural", "agriculture", "associated", "conditions", "degree", "depending", "economic", "environmental", "health", "labor", "law", "organized", "performs", "production", "related", "rights", "technology", "valley", "work".
0.300
Forage ↗ Q13377214 EXACT TITLE
annualdirectlyhistoricallylivestockmaterial
SHARED TOKENS (5): "annual", "directly", "historically", "livestock", "material". | EXACT TITLE in biotech_life_sciences: "Forage".
0.300
anotherapplicationsassociatedbecomeconcerningconditionscreatecurrentdevelopmentemergedfoundimportantmajormedicalmethodsopportunitiesphysicalpurposesrelatedrelevant
SHARED TOKENS (27): "another", "applications", "associated", "become", "concerning", "conditions", "create", "current", "development", "emerged", "found", "important", "major", "medical", "methods", "opportunities", "physical", "purposes", "related", "relevant"....
0.300
applicationsconditionscontrolcoveringdependingdifferentfoodhealthlivestockmanagementmedicalprofessionalresearchsafesafetysciencescopespecializedsupplytype
SHARED TOKENS (23): "applications", "conditions", "control", "covering", "depending", "different", "food", "health", "livestock", "management", "medical", "professional", "research", "safe", "safety", "science", "scope", "specialized", "supply", "type"....
0.300
consumergeneralinformationmultipleonlineoperatorproductproductionproductsproviderssellsinglesitetypeusers
SHARED TOKENS (15): "consumer", "general", "information", "multiple", "online", "operator", "product", "production", "products", "providers", "sell", "single", "site", "type", "users".
0.300
actadultallowingappliesauthorizedbasecommunitycompliancecontentdrinkingexamplesfacilityfederalfinalfundinggovernmentindividualjurisdictionlandlaw
SHARED TOKENS (44): "act", "adult", "allowing", "applies", "authorized", "base", "community", "compliance", "content", "drinking", "examples", "facility", "federal", "final", "funding", "government", "individual", "jurisdiction", "land", "law"....
0.300
approximatelyboisebuildingbuildingscomplexevenfoundhistoricalhouseidaholaterlessnearsinglesitewestern
SHARED TOKENS (16): "approximately", "boise", "building", "buildings", "complex", "even", "found", "historical", "house", "idaho", "later", "less", "near", "single", "site", "western".
0.300
dependdifferenteducationeducationalparticipationpopulationproductionprogramsresearchsciencestudentsstudiessubjectssurroundingtechniques
SHARED TOKENS (15): "depend", "different", "education", "educational", "participation", "population", "production", "programs", "research", "science", "students", "studies", "subjects", "surrounding", "techniques".
0.300
Pandero ↗ Q4898607 EXACT TITLE
associatedfamilyregionsinglesmall
SHARED TOKENS (5): "associated", "family", "region", "single", "small". | EXACT TITLE in basque_culture: "Pandero".
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagenciesagriculturalapplicationsassociationscomplexconditionscreatedevelopmentdifferentdiversityfoodgovernmentimportantinstitutionsinternationalknowledgelandmethodsorganizations
SHARED TOKENS (31): "additional", "agencies", "agricultural", "applications", "associations", "complex", "conditions", "create", "development", "different", "diversity", "food", "government", "important", "institutions", "international", "knowledge", "land", "methods", "organizations"....
0.300
applicationsappliedassociateddefinitionsdifferentengineeringfieldfunctionsinvolvingmaterialsmedicalmethodsperformportionspracticepurposerequirescopesupportsystem
SHARED TOKENS (20): "applications", "applied", "associated", "definitions", "different", "engineering", "field", "functions", "involving", "materials", "medical", "methods", "perform", "portions", "practice", "purpose", "require", "scope", "support", "system".
0.300
accuracyarchitecturedatafoundationallargelessmodelmodernnetworkprocessingsafetytechnologytexttrainedtrainingtype
SHARED TOKENS (16): "accuracy", "architecture", "data", "foundational", "large", "less", "model", "modern", "network", "processing", "safety", "technology", "text", "trained", "training", "type".
0.300
accessactivitiesadministrationassociationcapacitycontentcontroldepartmentdesignededucationalenvironmentalfederalfoodgovernmenthealthinformationinstitutionalinternationalleadershipmajor
SHARED TOKENS (34): "access", "activities", "administration", "association", "capacity", "content", "control", "department", "designed", "educational", "environmental", "federal", "food", "government", "health", "information", "institutional", "international", "leadership", "major"....
0.300
accordingaloneamonganotherappliescollectiondatadirectlyestablishestablishingidentifylevelspeoplepopulationratherreportedrepresentedresponsesmallspecified
SHARED TOKENS (22): "according", "alone", "among", "another", "applies", "collection", "data", "directly", "establish", "establishing", "identify", "levels", "people", "population", "rather", "reported", "represented", "response", "small", "specified"....
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in basque_culture: "Idaho Department of Health and Welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.300
Arts district ↗ Q1797194 KW CROSS HIGH
anotherassociatedbettercommercialconcentrationcreatedistrictseconomicfacilitiesfoundlargemassmultiplepeopleplacesplannersplanningproductionpublicrather
SHARED TOKENS (24): "another", "associated", "better", "commercial", "concentration", "create", "districts", "economic", "facilities", "found", "large", "mass", "multiple", "people", "places", "planners", "planning", "production", "public", "rather"....
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
commonlyconditionsculturedevelopmentenvironmentessentialformgenerallyhistoricalisolatedmaintainingmethodsneedoutsidepopulationpracticeregulatesrelatedreproducerequire
SHARED TOKENS (23): "commonly", "conditions", "culture", "development", "environment", "essential", "form", "generally", "historical", "isolated", "maintaining", "methods", "need", "outside", "population", "practice", "regulates", "related", "reproduce", "require"....
0.300
academicaccessagenciesannualapplicationsapproximatelybusinessescapitalcovereddevelopeddevelopmentdevelopsdiscoverydistinctdocumentededucationessentialevaluationexamplesfield
SHARED TOKENS (45): "academic", "access", "agencies", "annual", "applications", "approximately", "businesses", "capital", "covered", "developed", "development", "develops", "discovery", "distinct", "documented", "education", "essential", "evaluation", "examples", "field"....
0.300
activityagricultureannualeconomiclaborlargelessmassoperationsrestaurantssignificantstatisticsstatusthemworkers
SHARED TOKENS (15): "activity", "agriculture", "annual", "economic", "labor", "large", "less", "mass", "operations", "restaurants", "significant", "statistics", "status", "them", "workers".
0.300
accordingadministrationannualapprovalcentercommercecomplianceentityestablishmentevaluationeventsfacilitiesfoodforminformationlabelinglegallicenseproductproducts
SHARED TOKENS (28): "according", "administration", "annual", "approval", "center", "commerce", "compliance", "entity", "establishment", "evaluation", "events", "facilities", "food", "form", "information", "labeling", "legal", "license", "product", "products"....
0.300
boisebusinesscentercentralidaho
SHARED TOKENS (5): "boise", "business", "center", "central", "idaho". | EXACT TITLE in basque_culture: "Downtown Boise".
0.300
addresscategoriescommunitiescreationcurrentdevelopedeconomiceconomyformhealthmedicalpercentproductproductspurchasingrequirementssharesystem
SHARED TOKENS (18): "address", "categories", "communities", "creation", "current", "developed", "economic", "economy", "form", "health", "medical", "percent", "product", "products", "purchasing", "requirements", "share", "system".
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentityfederalgovernedgovernment
SHARED TOKENS (36): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entity", "federal", "governed", "government"....
0.300
conservationdepartmenteducationemployeeemployeesenforcementenvironmentalestablishingestablishmentexecutivefederalfederallygovernmenthouseindependentinformationlegallevelslocalmaintaining
SHARED TOKENS (30): "conservation", "department", "education", "employee", "employees", "enforcement", "environmental", "establishing", "establishment", "executive", "federal", "federally", "government", "house", "independent", "information", "legal", "levels", "local", "maintaining"....
0.300
accessaccordinganotherassetsassociationbecomecannotcombinescontentdatadependingdesignedformalfoundinformationlibrarymaterialmediamethodsplanning
SHARED TOKENS (32): "access", "according", "another", "assets", "association", "become", "cannot", "combines", "content", "data", "depending", "designed", "formal", "found", "information", "library", "material", "media", "methods", "planning"....
0.300
Vitoria-Gasteiz ↗ Q14318 KW CROSS HIGH
agriculturalamongawardcapitalcommunitydedicateddesignedeventsgeneralglobalgovernmenthistoricallyhousenearlyofficialplacespopulationrecognizedregionrelevant
SHARED TOKENS (25): "agricultural", "among", "award", "capital", "community", "dedicated", "designed", "events", "general", "global", "government", "historically", "house", "nearly", "official", "places", "population", "recognized", "region", "relevant"....
0.300
activeapprovalbecomecommercialcomplexcorporationsdevelopeddevelopmentdiscoveryentityexperiencefundinghealthhistoricallyidentificationidentifiedidentifyidentifyinginteractionisolated
SHARED TOKENS (38): "active", "approval", "become", "commercial", "complex", "corporations", "developed", "development", "discovery", "entity", "experience", "funding", "health", "historically", "identification", "identified", "identify", "identifying", "interaction", "isolated"....
0.300
activitiesassociateddescribeddiffersdistinctenvironmentenvironmentalexamplesfacilitiesgeneralhealthinvolvingmaterialmaterialsmedicaloperatingoriginproducersrequireresearch
SHARED TOKENS (23): "activities", "associated", "described", "differs", "distinct", "environment", "environmental", "examples", "facilities", "general", "health", "involving", "material", "materials", "medical", "operating", "origin", "producers", "require", "research"....
0.300
accesscontainerscontrolestablishedfacilitiesfacilityhealthlevelsmultiplepersonnelreportsroomsspecifiedsystemstraining
SHARED TOKENS (15): "access", "containers", "control", "established", "facilities", "facility", "health", "levels", "multiple", "personnel", "reports", "rooms", "specified", "systems", "training".
0.300
boardcreatefunctionsgenerallygovernmentinformationinfrastructurelocalmajormanagementmeetingsmembershiporganizationorganizationsprivaterolesupportingthereforeturn
SHARED TOKENS (19): "board", "create", "functions", "generally", "government", "information", "infrastructure", "local", "major", "management", "meetings", "membership", "organization", "organizations", "private", "role", "supporting", "therefore", "turn".
0.300
Folklore ↗ Q36192 KW CROSS HIGH
academicanotherbuildingculturecurriculumessentialformformalgraduateindividuallevelsmaterialpeopleregionschoolsharedstudiesstudytransmission
SHARED TOKENS (19): "academic", "another", "building", "culture", "curriculum", "essential", "form", "formal", "graduate", "individual", "levels", "material", "people", "region", "school", "shared", "studies", "study", "transmission".
0.300
applicationscodedesignengineeringevenfoundfunctiongeneralknowledgemarketmethodsproductproductionrecognitionresearchresearchersstructure
SHARED TOKENS (17): "applications", "code", "design", "engineering", "even", "found", "function", "general", "knowledge", "market", "methods", "product", "production", "recognition", "research", "researchers", "structure".
0.300
Tug of war ↗ Q102843 KW CROSS HIGH
activitycommunityeventsgoverngovernedhistoricalhistoryimportantinternationalmembersnationalorganizedphysicalprogramremainsrequiresriskrulestechniques
SHARED TOKENS (19): "activity", "community", "events", "govern", "governed", "historical", "history", "important", "international", "members", "national", "organized", "physical", "program", "remains", "requires", "risk", "rules", "techniques".
0.300
agriculturalagricultureapproximatelycommercialcommunitiescurrentdepartmentdirectlyexecutivefederalfoodgovernmentlivestocknationalproductionprogramprogramsreportsresourcessafety
SHARED TOKENS (20): "agricultural", "agriculture", "approximately", "commercial", "communities", "current", "department", "directly", "executive", "federal", "food", "government", "livestock", "national", "production", "program", "programs", "reports", "resources", "safety".
0.300
addressesannualapproximatelybureaucommunitiescommunitydataeducationalemploymentformfundinginformationlocalmajorplanproficiencyprogramstatuswestern
SHARED TOKENS (19): "addresses", "annual", "approximately", "bureau", "communities", "community", "data", "educational", "employment", "form", "funding", "information", "local", "major", "plan", "proficiency", "program", "status", "western".
0.300
associationsbuildingcommonlycommunitiescommunitydevelopmentdistinctexperiencegeographyhealthmodelneednetworksoperateoperatingorganizationorganizationsprojectssharedspace
SHARED TOKENS (21): "associations", "building", "commonly", "communities", "community", "development", "distinct", "experience", "geography", "health", "model", "need", "networks", "operate", "operating", "organization", "organizations", "projects", "shared", "space"....
0.300
actadministrationcertificationchildrencommonlydepartmentfacilitiesfederalgovhealthinsurancemaintainingprogramprogramsreportsstandardssystem
SHARED TOKENS (17): "act", "administration", "certification", "children", "commonly", "department", "facilities", "federal", "gov", "health", "insurance", "maintaining", "program", "programs", "reports", "standards", "system".
0.300
analysisapplicationsbecomebuildingconstructioncorporationdevelopeddifferentessentialidentificationisolatedmedicalmethodsregionresearchsciencesettingsinglesmallspecifically
SHARED TOKENS (21): "analysis", "applications", "become", "building", "construction", "corporation", "developed", "different", "essential", "identification", "isolated", "medical", "methods", "region", "research", "science", "setting", "single", "small", "specifically"....
0.300
actadministrationconditionscostsdepartmenteducationemploymentestablishedfederalhealthlaborlawmissionoccupationaloutreachregulatorysafesafetysettingstandards
SHARED TOKENS (21): "act", "administration", "conditions", "costs", "department", "education", "employment", "established", "federal", "health", "labor", "law", "mission", "occupational", "outreach", "regulatory", "safe", "safety", "setting", "standards"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherbusinesscapitalconditionscorporatecorporationdirecteconomicentityexplicitlyindividuallargelegallicensingmarketmeansmodelpracticeproductsproperty
SHARED TOKENS (28): "another", "business", "capital", "conditions", "corporate", "corporation", "direct", "economic", "entity", "explicitly", "individual", "large", "legal", "licensing", "market", "means", "model", "practice", "products", "property"....
0.300
Basque pelota ↗ Q212845 KW CROSS HIGH
concentratedcreationdependingdifferentdisciplinesevenforminternationalmodernnationalnetparticipationrelatedrulessafety
SHARED TOKENS (15): "concentrated", "creation", "depending", "different", "disciplines", "even", "form", "international", "modern", "national", "net", "participation", "related", "rules", "safety".
0.300
agricultureappliesassociatedbecomebusinessbusinessescontinuitycorefamilyidentifyidentifyinginternalinternationalleadershipmanagementmoveownershippeopleplanningsmall
SHARED TOKENS (20): "agriculture", "applies", "associated", "become", "business", "businesses", "continuity", "core", "family", "identify", "identifying", "internal", "international", "leadership", "management", "move", "ownership", "people", "planning", "small".
0.300
amongappliesassociatedassociationchildrencodecommunitycorporatecorporationeducationalexclusivelyfederalformindividualinternationalnationaloperationorganizationorganizationsorganized
SHARED TOKENS (28): "among", "applies", "associated", "association", "children", "code", "community", "corporate", "corporation", "educational", "exclusively", "federal", "form", "individual", "international", "national", "operation", "organization", "organizations", "organized"....
0.300
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahowestern
SHARED TOKENS (5): "agricultural", "approximately", "boise", "idaho", "western". | EXACT TITLE in biotech_life_sciences: "Boise River".
0.300
activitiesamonganalysisanotherbettercentercomplexconcerningconstructionconventionalcreatedatadatasetsdescriptiondifferentdisciplinesessentialfieldfunctionfunctions
SHARED TOKENS (49): "activities", "among", "analysis", "another", "better", "center", "complex", "concerning", "construction", "conventional", "create", "data", "datasets", "description", "different", "disciplines", "essential", "field", "function", "functions"....
0.300
Technology transfer ↗ KW CROSS HIGH
academicactivityanalysisanothercapacitycommercialconnectingcontrolcorecreationdevelopmentenvironmentestablishesfundinggivesglobalgovernmentimportantinfluenceinstitutions
SHARED TOKENS (40): "academic", "activity", "analysis", "another", "capacity", "commercial", "connecting", "control", "core", "creation", "development", "environment", "establishes", "funding", "gives", "global", "government", "important", "influence", "institutions"....
0.300
amongbackbetterdevelopmentdifferentengineeringhealthidentifiedindividualinitiativeleastmedicalmodelnationalorganizationspeoplepracticesproductsrelatedresponse
SHARED TOKENS (23): "among", "back", "better", "development", "different", "engineering", "health", "identified", "individual", "initiative", "least", "medical", "model", "national", "organizations", "people", "practices", "products", "related", "response"....
0.300
businessbusinessescommercialcreatefamilyidentifiedinfluenceleadershipmanagementmultipleorganizationownershiprelatedrelationshipstype
SHARED TOKENS (15): "business", "businesses", "commercial", "create", "family", "identified", "influence", "leadership", "management", "multiple", "organization", "ownership", "related", "relationships", "type".
🫐 BERRY64 edges
0.280
Transhumance ↗ Q4657754 KW CROSS HIGH
baseeconomicformgenerallyimpliesimportantlivestockmovementpeoplepopulationproductsthemtypewestern
SHARED TOKENS (14): "base", "economic", "form", "generally", "implies", "important", "livestock", "movement", "people", "population", "products", "them", "type", "western".
0.280
agriculturalanotherchildrenconnectioncultureeasternenvironmentenvironmentalinformationpeoplephysicalproductresearchwestern
SHARED TOKENS (14): "agricultural", "another", "children", "connection", "culture", "eastern", "environment", "environmental", "information", "people", "physical", "product", "research", "western".
0.280
accuracycommercededicatedevaluationexperienceformonlineproductproductsprofessionalpurchasingreviewsitesusers
SHARED TOKENS (14): "accuracy", "commerce", "dedicated", "evaluation", "experience", "form", "online", "product", "products", "professional", "purchasing", "review", "sites", "users".
0.280
Alfalfa ↗ Q156106 EXACT TITLE
commonlyfamilyimportantlivestock
SHARED TOKENS (4): "commonly", "family", "important", "livestock". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.280
federalregulatoryresearchstandards
SHARED TOKENS (4): "federal", "regulatory", "research", "standards". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.280
agricultureanotherapplicationsfoodhealthinformationlifemajorphysicalsciencestandardstudiesstudytype
SHARED TOKENS (14): "agriculture", "another", "applications", "food", "health", "information", "life", "major", "physical", "science", "standard", "studies", "study", "type".
0.280
Biophysics ↗ Q7100 EXACT TITLE
appliesmethodssciencestudy
SHARED TOKENS (4): "applies", "methods", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.260
localregiontype
SHARED TOKENS (3): "local", "region", "type". | EXACT TITLE in basque_culture: "Basque cuisine".
0.260
Charcuterie ↗ Q260568 EXACT TITLE
dedicatedproductsrestaurants
SHARED TOKENS (3): "dedicated", "products", "restaurants". | EXACT TITLE in basque_culture: "Charcuterie".
0.260
culturepeopleregion
SHARED TOKENS (3): "culture", "people", "region". | EXACT TITLE in basque_culture: "Basque Country".
0.260
beyondbusinessbusinessesearlyentrepreneurshipfundinginfluencelargemodelprivateprojectpublicsignificant
SHARED TOKENS (13): "beyond", "business", "businesses", "early", "entrepreneurship", "funding", "influence", "large", "model", "private", "project", "public", "significant".
0.260
purposesresearchstudy
SHARED TOKENS (3): "purposes", "research", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.260
accordinggenerallypurpose
SHARED TOKENS (3): "according", "generally", "purpose". | EXACT TITLE in basque_culture: "Bertsolaritza".
0.240
complexconcentrationdominantinfluencemodelmodelsplacesrelationshipsrepresentsresponsestudytools
SHARED TOKENS (12): "complex", "concentration", "dominant", "influence", "model", "models", "places", "relationships", "represents", "response", "study", "tools".
0.240
associatedclassificationinformationknowledgemajorprocessingrecognitionrelatedrepresentationsciencesystemtext
SHARED TOKENS (12): "associated", "classification", "information", "knowledge", "major", "processing", "recognition", "related", "representation", "science", "system", "text".
0.240
Wine bar ↗ Q133575172 KW CROSS HIGH
additionalassociatedbusinessestablishmentsfunctionlicensingoriginprivaterathersellstand-alonetype
SHARED TOKENS (12): "additional", "associated", "business", "establishments", "function", "licensing", "origin", "private", "rather", "sell", "stand-alone", "type".
0.240
agriculturalanothercommunitydepartmentdistinctdistributedeasternformmajormunicipalpopulationregion
SHARED TOKENS (12): "agricultural", "another", "community", "department", "distinct", "distributed", "eastern", "form", "major", "municipal", "population", "region".
0.240
actcoveringdepartmentfederalhistoricalmanagementnationalpeopleplacespublicthemtitle
SHARED TOKENS (12): "act", "covering", "department", "federal", "historical", "management", "national", "people", "places", "public", "them", "title".
0.240
Folk music ↗ Q43343 KW CROSS HIGH
appliedassociatedbeyondcommercialdistinctformgenerallyidentitynationalpeoplesmallertype
SHARED TOKENS (12): "applied", "associated", "beyond", "commercial", "distinct", "form", "generally", "identity", "national", "people", "smaller", "type".
0.220
Serology ↗ Q502159 EXACT TITLE
responsestudy
SHARED TOKENS (2): "response", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.220
activitiescategoriesenvironmentalestablishedhealthlessmultiplerisksafestandardstype
SHARED TOKENS (11): "activities", "categories", "environmental", "established", "health", "less", "multiple", "risk", "safe", "standards", "type".
0.220
idahooffice
SHARED TOKENS (2): "idaho", "office". | EXACT TITLE in basque_culture: "Pete Cenarrusa".
0.220
applicationsdesigneddevelopedfieldinternalmedicalprogramregulatedresearchsingletest
SHARED TOKENS (11): "applications", "designed", "developed", "field", "internal", "medical", "program", "regulated", "research", "single", "test".
0.220
peopletype
SHARED TOKENS (2): "people", "type". | EXACT TITLE in basque_culture: "Basque dance".
0.220
anotherbackcommunityfamilyhistoricallyimportantlocallyoriginratherregisteredtype
SHARED TOKENS (11): "another", "back", "community", "family", "historically", "important", "locally", "origin", "rather", "registered", "type".
0.220
Cold chain ↗ KW CROSS HIGH
activitiesagriculturalassociateddistributedfoodmanagementproductionproductsrequiressafetysupply
SHARED TOKENS (11): "activities", "agricultural", "associated", "distributed", "food", "management", "production", "products", "requires", "safety", "supply".
0.210
according
SHARED TOKENS (1): "according". | EXACT TITLE in basque_culture: "Basque Americans".
0.200
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
accordingboisecanyoncollegeidahonorthwestpopulationprincipaluniversitywestern
SHARED TOKENS (10): "according", "boise", "canyon", "college", "idaho", "northwest", "population", "principal", "university", "western".
0.200
Pincho ↗ Q1452513 KW CROSS HIGH
anotherculturefoodindependentlyindividuallocalportionsrelatedsmallthem
SHARED TOKENS (10): "another", "culture", "food", "independently", "individual", "local", "portions", "related", "small", "them".
0.200
differentenvironmentenvironmentalforminteractionpathwaysrelationshiprelationshipsstudythem
SHARED TOKENS (10): "different", "environment", "environmental", "form", "interaction", "pathways", "relationship", "relationships", "study", "them".
0.200
Urban renewal ↗ Q920600 KW CROSS HIGH
businessescommunitiesconstructioneconomicgovernmentinfrastructurelandprivateprojectspublic
SHARED TOKENS (10): "businesses", "communities", "construction", "economic", "government", "infrastructure", "land", "private", "projects", "public".
0.200
boisebuildingbuildingscapitalidahonationalplacespropertysurroundingwestern
SHARED TOKENS (10): "boise", "building", "buildings", "capital", "idaho", "national", "places", "property", "surrounding", "western".
0.200
administrationconcentrationdedicateddescribingfoodinfluencemodelsplacesrelationshipstudy
SHARED TOKENS (10): "administration", "concentration", "dedicated", "describing", "food", "influence", "models", "places", "relationship", "study".
0.200
Biomarker ↗ EXACT TITLE
conditionresponses
EXACT TITLE in biotech_life_sciences: "Biomarker".
0.180
acquisitionformalindividualinfluenceinteractionknowledgeresearchrolestudies
SHARED TOKENS (9): "acquisition", "formal", "individual", "influence", "interaction", "knowledge", "research", "role", "studies".
0.180
Water quality ↗ Q625376 KW CROSS HIGH
compliancedrinkinggenerallyhealthphysicalsafetysignificantstandardssupply
SHARED TOKENS (9): "compliance", "drinking", "generally", "health", "physical", "safety", "significant", "standards", "supply".
0.180
dataengineeringfunctionhealthphysicalpopulationpracticeresearchseparate
SHARED TOKENS (9): "data", "engineering", "function", "health", "physical", "population", "practice", "research", "separate".
0.180
facilitieshealthidahonetworkoperatesoperatingpeoplesupportsystem
SHARED TOKENS (9): "facilities", "health", "idaho", "network", "operates", "operating", "people", "support", "system".
0.160
currentdirectdirectlyeasternhistoricallymodernstandardwestern
SHARED TOKENS (8): "current", "direct", "directly", "eastern", "historically", "modern", "standard", "western".
0.160
documentationdocumentsearlyfieldhistoricalhistorymaterialsrecords
SHARED TOKENS (8): "documentation", "documents", "early", "field", "historical", "history", "materials", "records".
0.160
associatedboisecenterfederallyidahopopulationrecognizedvalley
SHARED TOKENS (8): "associated", "boise", "center", "federally", "idaho", "population", "recognized", "valley".
0.160
Seed testing ↗ Q7445654 KW CROSS HIGH
analysisdedicateddesignedpurposesresearchsoldtechniquestrained
SHARED TOKENS (8): "analysis", "dedicated", "designed", "purposes", "research", "sold", "techniques", "trained".
0.160
Sheep farming ↗ Q1790941 KW CROSS HIGH
adultconditionscontrolfacilitiesmarketnearpropertyregion
SHARED TOKENS (8): "adult", "conditions", "control", "facilities", "market", "near", "property", "region".
0.160
Navarre ↗ Q4018 KW CROSS HIGH
annualcapitalcommunitymakesproducesregionsanwestern
SHARED TOKENS (8): "annual", "capital", "community", "makes", "produces", "region", "san", "western".
0.160
amongdiversityknowledgeperformancerelatedsitestypewestern
SHARED TOKENS (8): "among", "diversity", "knowledge", "performance", "related", "sites", "type", "western".
0.140
Gipuzkoa ↗ Q95010 KW CROSS HIGH
capitalcommunitydepartmenthistoricalimportantpopulationsan
SHARED TOKENS (7): "capital", "community", "department", "historical", "important", "population", "san".
0.140
accordinganalysiscentralhistoricalmaterialstudysystem
SHARED TOKENS (7): "according", "analysis", "central", "historical", "material", "study", "system".
0.140
Select agent ↗ KW CROSS HIGH
affectingagriculturedepartmenthealthlawpublicsafety
SHARED TOKENS (7): "affecting", "agriculture", "department", "health", "law", "public", "safety".
0.140
Folk dance ↗ Q201022 KW CROSS HIGH
evenlifenearlyoriginpeoplepurposeregion
SHARED TOKENS (7): "even", "life", "nearly", "origin", "people", "purpose", "region".
0.140
academicdegreeeducationgraduateprofessionalschoolstudents
SHARED TOKENS (7): "academic", "degree", "education", "graduate", "professional", "school", "students".
0.140
backbecomedifferentmultiplerecognizedsitesspecifically
SHARED TOKENS (7): "back", "become", "different", "multiple", "recognized", "sites", "specifically".
0.140
Lifting stone ↗ Q3997677 KW CROSS HIGH
centeredestablishedeventsfoundincorporatedpeopleplatform
SHARED TOKENS (7): "centered", "established", "events", "found", "incorporated", "people", "platform".
0.120
Álava ↗ KW CROSS HIGH
capitalcommunityhistoricalinstitutionsleastpopulation
SHARED TOKENS (6): "capital", "community", "historical", "institutions", "least", "population".
0.120
administrationfoodinternationalmeansprogramregulatory
SHARED TOKENS (6): "administration", "food", "international", "means", "program", "regulatory".
0.120
Biscay ↗ Q93366 KW CROSS HIGH
capitalcommunityeconomyhistoricallylatermajor
SHARED TOKENS (6): "capital", "community", "economy", "historically", "later", "major".
0.120
adaamongboisecapitalidahopopulation
SHARED TOKENS (6): "ada", "among", "boise", "capital", "idaho", "population".
0.100
businesseslicenseofficialotherwisesell
SHARED TOKENS (5): "businesses", "license", "official", "otherwise", "sell".
0.100
currentexecutivegovernmentidahooffice
SHARED TOKENS (5): "current", "executive", "government", "idaho", "office".
0.100
Medical test ↗ Q2671652 KW CROSS HIGH
analysismedicalphysicalsettingtest
SHARED TOKENS (5): "analysis", "medical", "physical", "setting", "test".
0.100
agriculturalidaholandmajornorthwest
SHARED TOKENS (5): "agricultural", "idaho", "land", "major", "northwest".
0.100
categoryemployeesfoodplanningrestaurants
SHARED TOKENS (5): "category", "employees", "food", "planning", "restaurants".
0.100
Jai alai ↗ Q1193361 KW CROSS HIGH
appliedinvolvingmeanstypewhose
SHARED TOKENS (5): "applied", "involving", "means", "type", "whose".
0.100
communitydifferentformmovementwestern
SHARED TOKENS (5): "community", "different", "form", "movement", "western".
0.100
nationalofficialpeoplepopulationrecognized
SHARED TOKENS (5): "national", "official", "people", "population", "recognized".
◈ Frequently Asked Questions
Basque Culture × Biotech Life Sciences — Treasure Valley
HAIKU · HIGH GATE
How have Basque agricultural traditions in the Treasure Valley influenced food and beverage product development in local biotech companies?
Basque sheepherding families settled Ada County and Canyon County during the late 19th and early 20th centuries, establishing agricultural networks that remain embedded in Treasure Valley food production. Biotech life sciences companies operating in Boise and Caldwell now access these historical agricultural knowledge systems when developing food-related products and FDA-regulated dietary supplements.
What role do Basque community networks in Boise play in attracting private equity funding to Treasure Valley biotech startups?
The Basque cultural institutions in Boise's Ada County region maintain long-standing commercial and family networks that extend into capital formation circles throughout the Pacific Northwest. Private equity investors evaluating biotech opportunities in the Treasure Valley often engage with established Basque business families and their documented track records of commercial stewardship dating to agricultural enterprises.
Are there Basque-connected research initiatives at Boise State University or Idaho State University focused on life sciences?
Boise State University and Idaho State University draw from the Treasure Valley's approximately 5,000-person Basque population for research collaboration and community-engaged science programs. Both institutions have documented partnerships with Basque cultural organizations in Ada County that inform agricultural biotechnology and food science research agendas aligned with FDA regulatory pathways.
How does the Basque population in the Treasure Valley contribute to the biotech workforce in the Boise metropolitan area?
The Basque community in the Boise metropolitan area, concentrated in Ada County, has generated multigenerational professional families with expertise in agricultural science, business operations, and public health—skills directly applicable to biotech life sciences employment. Idaho State University and Boise State University graduates with Basque family backgrounds represent a documented talent pipeline for FDA-regulated manufacturing and product development roles across the Treasure Valley's biotech sector.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Basque Culture × Biotech Life Sciences 11 QID bridges 257 edges 7,030 ext links 2026-07-17 19:34:06 UTC 2d99578b33aa0a58
Basque Culture corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Basque Culture ↗ boisestandard.org/standard ↗
Parent Corridors
Basque Culture × All Other Verticals